KEGG   Escherichia sp. E4742: FEM44_00670
Entry
FEM44_00670       CDS       T06276                                 

Gene name
gatD
Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
esz  Escherichia sp. E4742
Pathway
esz00052  Galactose metabolism
esz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FEM44_00670 (gatD)
Enzymes [BR:esz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     FEM44_00670 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C 2-Hacid_dh_C Shikimate_DH 3HCDH_N Methyltransf_25 PrmA ADH_zinc_N_2 UDPG_MGDP_dh_N TrkA_N ELFV_dehydrog FAD_binding_2 MTS Methyltransf_11
Other DBs
NCBI-ProteinID: QCT85838
LinkDB
Position
complement(109247..110287)
AA seq 346 aa
MKSVVNDTDGVVRVVEKVIPEINHQDEVRVKIASSGVCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGPGVDDLQPGDAVACVPLLPCFNCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRKNVFPLPADMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISPEKLALAKSFGAMQTFNSSETSAAQMQSVLRELRFNQLILETAGVP
QTVELGVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFAQSVRDIARNTMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtgtcgtgcgcgttgtagaaaaagttattcct
gaaattaatcatcaggatgaggtgcgggtaaaaattgccagctcgggggtatgtggttcc
gatttacccagaatttttaaaaatggtgcacattattatccaataacgttaggccatgaa
tttagtggctatattgatgcggtgggacccggtgttgatgatttacaacctggcgatgca
gttgcctgtgtgccgttattaccctgttttaattgcccggagtgtctgaaagggttttat
tcccagtgtgcgaaatatgattttattggttcgcgacgtgatggtggatttgccgaatat
attgtcgttaagcgaaaaaatgtttttccactacccgcggatatgcctattgaggatggg
gcttttattgaaccgattaccgttggcctgcatgctttccatttagcgcaaggttgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggcaattcagtgcgct
gtcgcgctgggggcaaagagtgtgacggctatcgacattagcccagaaaaactggcactg
gcaaaatccttcggcgcgatgcaaacatttaacagtagcgaaacgagcgcggcgcaaatg
cagagcgttttacgcgaactgcgcttcaaccagcttatcctcgagacagcaggcgtaccg
caaaccgtcgaactgggggtggaaatcgccgggcctcacgcacaactggcactggtggga
acgttacatcaggatctgcatttaacatccgcgacatttggcaaaatattgcgtaaagag
ctgacggttatcggcagttggatgaactactccagcccgtggcctgggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaaagcttcgcccagtcggtgcgtgacatcgctcgcaataccatgccgggt
aaagtgttgctcattccctga

DBGET integrated database retrieval system