KEGG   Escherichia sp. E4742: FEM44_05500
Entry
FEM44_05500       CDS       T06276                                 

Definition
(GenBank) OmpA family protein
Organism
esz  Escherichia sp. E4742
SSDB
Motif
Pfam: OmpA TMC
Other DBs
NCBI-ProteinID: QCT86716
LinkDB
Position
complement(1141751..1143430)
AA seq 559 aa
MRGSVIIPVALHVLVAVATLLWLLWYFIPAGNVFNGLTTLLILLLAGWTVFKNCRSEKQK
LTSDVTLTDAEPALSGTRAPVVLVCGDMPEALFQDGPLRKTARGCWLRVGDVSRLTDVVR
SIQTQFPRQVGQLSVMYRCLPDWHHDEAVLRFTLKTLRQQCNQIKSLTGFALPVVLSAEF
SGPETPWIIVRGDKPVVCPVNHAPQAFTDWLQVEANILALPAVSEAFSFIRNTLADELEK
ADRLTPPVRAFSVAMRLGAVLPGTPSVWSDRLCSRTCLQFSRKPGQTVSAGMFPDAVLSL
LAPFASTVQGGQRTRRLILLIWLCVLTALGISALNNRDLIRQVSTDLQRWNAVPMDHYRP
KAESLAALKQDALLLEQWQRQGVPLRYSLGYYPGQRLWLALQQAIDTWVPPLPAPEPEAP
PQIIRLDSLALFDAGKWTLKPGATKWLVNALVDIKAKAGWLIVVSGHTDNTGDPQRNQVL
SLKRAEAVRDWMRDTGDIPQSCFAVQGYGESRPVAPNDTAEGRARNRRVEISLVPQADAC
RLPDASPAPEEGASENITE
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcgtggctctgtcatcattccggtagccctgcacgtcctggtggctgttgccacattg
ctgtggttgttgtggtatttcattccggcaggcaatgtttttaacggtctgactactctg
ctgatccttcttctggcaggctggactgtttttaaaaactgccggagtgaaaagcaaaag
ctcacatctgacgttaccctgacagatgctgaaccggcattatccggcacccgggcccct
gttgtactggtgtgtggtgacatgccggaagcgttgtttcaggacggtcctctgcgtaaa
acagcccggggatgctggctgcgggtcggtgatgtcagccgcttaactgacgttgtccgc
agcatacagacgcagttcccgcgccaggtcggtcagctctctgtgatgtaccgctgcctg
ccagactggcatcatgatgaagcggttcttcgtttcacactgaaaactctccgccagcag
tgtaatcagattaaatccctgacggggttcgcactgccggtggtgttgagtgccgaattt
tccgggcctgaaacaccgtggataatcgtccggggtgataaaccagttgtatgcccggtt
aatcatgcacctcaggcgttcactgactggctgcaggtggaagccaatattctggcgctg
ccggccgtcagcgaggcattttcctttattcgtaatacgctggctgatgagctggaaaaa
gctgaccggctgacgccacctgtacgagcattttccgttgcaatgcgccttggtgcagtt
cttccggggaccccgtcagtctggtccgacaggctctgttcccgtacctgtttgcagttt
tcccgaaaaccggggcagacagtgtcggcagggatgttcccggatgcggttctgtcgctg
ctggcaccttttgcgtcgacggtacagggaggccagcgtacccgtcgtctgattttgctg
atatggctgtgtgttctgaccgcgctggggatttctgcgcttaacaatcgtgatctgatc
cgtcaggtaagcaccgatttacagcgctggaatgctgtcccgatggatcactaccgtcct
aaggcggaatcgctggctgcactgaaacaggacgcgcttctgcttgagcagtggcagcgt
cagggagtgcctttacgttacagcctcggttattacccggggcaacgcctgtggctggcc
ctgcagcaggctatcgatacctgggttccgcctttaccagcgccggagccggaagcacct
ccgcaaatcatccgtctcgacagtctggcgctgtttgatgccggtaaatggacgctgaag
ccgggcgccacaaaatggctggtgaatgccctggtggatattaaggcaaaagcaggctgg
ctgattgtggtcagtggccacacggacaataccggtgacccgcagcgcaaccaggtcctg
tccctgaagcgtgcagaggccgttcgcgactggatgcgggataccggcgatattccccaa
agctgttttgccgtgcagggatacggtgaaagccgccctgtggccccgaatgacacggcg
gaaggccgtgcgcgtaaccgccgtgttgaaatcagtctggtaccgcaggccgatgcctgt
cgtctgccggacgcttcccctgcgccggaagagggcgcatcagaaaacataacggagtaa

DBGET integrated database retrieval system