KEGG   Escherichia sp. E4742: FEM44_12315Help
Entry
FEM44_12315       CDS       T06276                                 

Definition
(GenBank) D-lyxose/D-mannose family sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
esz  Escherichia sp. E4742
Pathway
esz00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:esz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FEM44_12315
Enzymes [BR:esz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     FEM44_12315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2 Cupin_1 AraC_binding Catalase-rel
Motif
Other DBs
NCBI-ProteinID: QCT87921
UniProt: A0A4P9DBX4
LinkDB All DBs
Position
complement(2537039..2537722)
Genome map
AA seq 227 aa AA seqDB search
MKRSAINDILGHTRQFFSQHDVHLPPFASFTPAQWQQLDTTAWEEVFDLKLGWDVTAFGS
NDFAAQGLTLFTLRNGSPKGMPYAKCYAEKIMHVRDAQVTPMHFHWRKREDIINRGGGNL
IVELWNADSNEQTVDSDVTVVIDGCRQKHTAGSQLRLSPGESICLPPGLYHSFWAEAGFG
DVLVGEVSSVNDDDHDNHFLQPLDRYNLIDEDEPAQLVLCNEYRQFR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctccgctataaacgacattctcggccatacacggcaattcttttcgcaacat
gacgtgcatcttccgccctttgccagtttcacacctgcccaatggcaacaactcgacacc
accgcgtgggaggaagtttttgatctcaaactcggctgggatgttaccgcttttggtagc
aacgactttgctgcacaggggctgacgctgtttaccctgcgtaacggttcgccaaaagga
atgccgtatgcgaaatgttacgccgagaagatcatgcatgtgcgcgatgcgcaggtaacg
ccaatgcattttcactggcgtaagcgtgaggacattatcaatcgcggcggcggcaatttg
attgttgaactatggaatgccgatagcaacgagcaaacggttgatagcgacgttacggtg
gtgatcgacggctgccgccagaaacataccgcaggcagtcagttgcgcctgtctcccggc
gaaagtatctgcctgccgccaggcctttatcacagcttttgggcagaagccggttttggc
gatgtgctggttggcgaagtctcttctgttaatgacgacgaccacgataaccacttttta
cagccgctggaccgctacaacctgattgacgaagacgaaccggcccagttggtgttgtgt
aacgaataccgccagttccgctga

DBGET integrated database retrieval system