KEGG   Erwinia tasmaniensis: ETA_02770Help
Entry
ETA_02770         CDS       T00711                                 

Gene name
accC
Definition
(GenBank) Acetyl CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00061  Fatty acid biosynthesis
eta00620  Pyruvate metabolism
eta00640  Propanoate metabolism
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
eta01120  Microbial metabolism in diverse environments
eta01130  Biosynthesis of antibiotics
eta01200  Carbon metabolism
eta01212  Fatty acid metabolism
Module
eta_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:eta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETA_02770 (accC)
   00640 Propanoate metabolism
    ETA_02770 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETA_02770 (accC)
Enzymes [BR:eta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ETA_02770 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ETA_02770 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Dala_Dala_lig_C ATP-grasp GARS_A RimK ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CAO95323
UniProt: B2VL78
LinkDB All DBs
Position
complement(328521..329870)
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLADETVCIGPPPSVKSY
LNIPALISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIFIGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGPLTEDMDKNRAFAKRIGYPVIIKASGGGGGRGMRVVRSDKDLEQ
SINMTKAEAKAAFNNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITEEMRRYIGERCSKACIDISYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEEVIIRGHAVECRINAEDANTFLPSPGKITRFHAP
GGFGVRWESHIYAGYSVPPYYDSMIGKLITFGENRDVAISRMKNALAELIIDGIKTNVEL
QMKIMSDENFQHGGTNIHYLEKKLGLQEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctggataaaattgtaattgctaaccgtggtgaaattgcgctgcgtattctgcgtgcc
tgtaaagagctgggcattaaaacggttgcggtgcactccacggccgatcgcgacctgaag
cacgtgctgctggcagatgaaaccgtctgtattggcccccctccgtcagtgaaaagctat
ctgaatatcccggcgctgatttctgccgccgagatcaccggtgcggtggctattcaccct
ggctacggcttcctctctgaaaatgcagacttcgctgagcaggttgagcgttcgggcttt
atctttatcggccccaaagcggatactatccgtctgatgggcgataaagtgtcggcgatc
accgcaatgaaaaaagcgggcgttccgacggttccgggctctgacggcccactgaccgag
gatatggataagaaccgcgcctttgcgaaacgcatcggctacccggtgattatcaaagcc
tccggcggcggcggcggtcgcggtatgcgcgtcgtgcgcagcgacaaagacctggaacaa
tccatcaacatgacgaaagcggaagccaaagcggctttcaacaacgacatggtttatatg
gaaaaatacctggaaaacccgcgtcatatcgaaattcaggtattggcagacggccagggc
aacgcgatatatctggccgaacgcgactgctccatgcagcgccgtcaccagaaagtggtg
gaagaagcgccggcaccgggcatcaccgaagagatgcgtcgctacattggcgaacgctgc
tcgaaagcctgtatcgatatcagctatcgcggcgcgggcaccttcgagttcctgtatgaa
aacggtgagttctacttcattgagatgaacacccgtattcaggttgagcatccggtcacc
gagatgatcaccggcgttgacctgatcaaagagcagctgcgcatcgctgccggtcagccg
ctgtcgatcaaacaggaagaggtcattattcgtggtcacgcggtggaatgccgtatcaac
gccgaagatgcgaatactttcctgccaagcccgggcaaaattacccgcttccacgcgccg
ggtggttttggcgtgcgttgggaatcccatatctacgccggttacagcgtgccgccgtac
tatgactcaatgattggcaaactgattacctttggtgaaaaccgtgatgtggcgatttca
cgcatgaaaaatgcgctggctgaactgatcatcgacgggatcaagaccaacgtcgaactg
cagatgaaaatcatgtcggacgagaacttccagcacggtggaacaaacatccactatctg
gagaaaaaactcggcctgcaagagaagtaa

DBGET integrated database retrieval system