KEGG   Erwinia tasmaniensis: ETA_07490Help
Entry
ETA_07490         CDS       T00711                                 

Gene name
ftsI
Definition
(GenBank) Peptidoglycan synthetase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00550  Peptidoglycan biosynthesis
eta01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETA_07490 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ETA_07490 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eta01011]
    ETA_07490 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eta03036]
    ETA_07490 (ftsI)
Enzymes [BR:eta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ETA_07490 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:eta01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ETA_07490 (ftsI)
Chromosome and associated proteins [BR:eta03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    ETA_07490 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CAO95795
UniProt: B2VD88
LinkDB All DBs
Position
837271..839043
Genome map
AA seq 590 aa AA seqDB search
MRAAKKTQKQKAKRTEDQASFVSWRFALLCGCIFLGLVGLLLRVAYLQVINPDRLVREGD
MRSLRVQAIPTSRGMISDRAGRPLAVSVPVNAIWADPKELHDKGGITLDSRWKALSDALS
IPLDQLAARVNANPNGRFVYLARQVNPAIGDYIRKLKLPGIFLREESRRYYPAGEVTSHL
IGFTNIDGQGIEGVEKSFDKWLTGQPGERTVRKDRFGRVIEDISSVDSRAAHNLALSIDE
RLQAQVYRELNNAVAFNKAESGTAVLLDINTGEVLAMANSPAYNPNNLTGVTKDVMRNRA
ITDMFEPGSTVKPMVVMTALQRGVVHESSVLNTVPFRINGHEIRDVARYNELTLTGVLQK
SSNVGVSRLALAMPSNALVDTYSRFGLGKATNLGLVGESSGLYPQKQRWADIERATFSFG
YGLMVTPLQLARVYATLGSYGIYRPLSITKVDPPVAGERVFPEPLVRTVLHMMESVALPG
GGGVKAAIKGYRIAIKTGTAKKVGPDGKFVNRYIAYTAGVAPASKPRFALVVVINDPQSG
KYYGGAVSAPVFGAIMGGVLRTMNVEPDALPTIDKNEMVTNKNEALSGRS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgagagccgcaaaaaaaacgcagaagcagaaagcgaaacgtacggaagatcaggccagc
tttgtcagctggcgttttgcattgctgtgcggctgtatttttctcggactggtagggcta
ctgctgcgggtggcgtatttgcaggtgatcaatcccgacaggctggtgcgtgaaggggat
atgcgctcactgcgcgtacaggctatcccgacatcgcgcggtatgatcagcgaccgcgcc
ggtcgtccgctggcggtcagcgttccggttaatgccatctgggccgatccgaaagagctg
cacgacaagggcggaattacgcttgatagccgctggaaagccctgtcagacgcgctttcg
atcccgcttgaccagctggcggcgcgagtcaatgctaatcctaacgggcgctttgtctat
ctggcgcgtcaggtgaatccggcgatcggtgactacatcagaaagctgaagctgcccggc
atcttcctgcgcgaggaatcacgacgctattatcctgccggagaggtcacctcgcacctg
attggatttaccaacattgacgggcagggcattgaaggcgttgagaaaagcttcgataaa
tggctgaccgggcagcccggcgaacgaacggtacgtaaagatcgttttggccgggtaata
gaagatatctcctccgtggatagccgggcggcacacaacctggctttaagtatcgatgag
cgcctgcaggcgcaggtgtatcgcgaactgaataacgcggtggcttttaacaaagcggaa
tccgggacggcggttctgctggatattaataccggcgaagtgttggcgatggccaacagc
ccggcctataacccgaataatctgaccggcgtcaccaaagacgtgatgcgcaatcgggct
atcaccgacatgtttgaaccaggctcaacggtgaagcccatggtggtgatgaccgcactc
cagcgcggcgtagtgcatgaaagcagcgtgctgaataccgttccttttcgaatcaacggt
catgaaatcagagatgtggcgcgctataacgaactgacgctgaccggggtgttacagaaa
tcgtcgaacgtgggcgtctcccgactggcgttagcgatgccttccaatgcgttagtggat
acctactcacgttttggcttaggtaaagcgaccaatttagggctggttggagaaagcagc
gggctgtacccacagaaacagcggtgggccgacatagaaagggcgaccttctcctttggc
tacgggctgatggtcacgccgctacagctggcgcgagtttatgcaacgttgggcagttat
ggcatttatcgtcccctgtcgataaccaaagttgacccaccggtagcgggggagcgcgtg
ttccctgaaccgctggtacgcacggtgctacatatgatggaaagcgtcgccctgccgggc
ggcggcggcgtaaaagccgccatcaagggttatcgtattgccatcaaaaccggtacggcc
aagaaggtggggccagacggtaaattcgtcaaccgctacattgcctataccgccggggtt
gctccggccagcaaaccgcgttttgcgctggtggtggtgataaacgatccccagtcaggc
aaatattacggtggtgcggtatccgcaccggtgtttggcgccattatggggggcgtactg
cgcaccatgaacgttgaaccggatgcgttacccactattgataagaatgagatggtaact
aacaaaaatgaggcactcagtggcagatcgtaa

DBGET integrated database retrieval system