KEGG   Erwinia tasmaniensis: ETA_07570Help
Entry
ETA_07570         CDS       T00711                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00473  D-Alanine metabolism
eta00550  Peptidoglycan biosynthesis
eta01100  Metabolic pathways
eta01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ETA_07570 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETA_07570 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ETA_07570 (ddl)
Enzymes [BR:eta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ETA_07570 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:eta01011]
 Precursor biosynthesis
  Amino acid ligase
   ETA_07570 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 ATPgrasp_Ter ATP-grasp TTL RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CAO95803
UniProt: B2VD93
LinkDB All DBs
Position
848082..849002
Genome map
AA seq 306 aa AA seqDB search
MAEKVAVLLGGTSAERDVSLLSGAAVLKGLKEAGIDAHAIDIRDFPAMRLKEEGFDKAFI
ALHGRGGEDGTLQGVLEFLAIPYTGSGVMASAITMDKLRSKYLWQGCGLPVSPFVALNRA
QMDAGLDAQLMTSIDALGLPLFVKPSREGSSVGISRVNQASELQAALQEAFRFDDEVLVE
AFLSGPEYTVGVIGTDILPSIRIQTASEFYDYDAKYLSDETQYFCPSGLSADQEAELREL
TIAAWRALGCSGWGRVDVMMGADGQFYLLEVNTSPGMTSHSLVPMAANQAGMSFSQLVAR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaagtcgcggtattgctgggtggaacctccgcagaacgagatgtgtcgctg
ttatccggagcagcggtcctgaaggggcttaaggaagccggaattgatgcacacgcgatt
gatattcgtgattttccggcgatgcgcctgaaagaagaaggtttcgataaagcctttatc
gcgctacatgggcgcggcggtgaagacggcaccctacagggcgtgctggagtttctggcg
atcccctataccggcagcggcgtgatggcttcggcgatcaccatggacaaactgcgcagt
aaatatctgtggcagggctgtgggctcccggtgtcgccctttgtggcgcttaatcgtgca
caaatggatgcggggctggatgcgcagctgatgacaagcatcgacgcgctgggattaccg
ctgtttgtcaaacccagtcgtgaaggctccagcgtgggtatttcgcgcgttaaccaggct
tcagaattgcaggctgcgctgcaagaagccttccgttttgacgatgaagtgctggtagaa
gcgtttctcagcggccccgaatacaccgtgggggtgatcggcacggacattctgccatct
atccgtattcagaccgccagcgagttctatgactatgatgcaaagtacctttctgatgaa
actcaatacttttgtccgtcagggttgagcgccgaccaggaagcggaacttcgcgaactg
accatcgccgcctggcgcgctctgggttgcagcggctgggggcgtgtcgatgtgatgatg
ggcgcagatgggcagttttacctgctggaggtcaatacctccccagggatgacaagccat
agcctggtaccgatggcggccaaccaggccggcatgagtttttcacagctggtagcgcgc
attctggaactggccgactga

DBGET integrated database retrieval system