KEGG   Erwinia tasmaniensis: ETA_18260Help
Entry
ETA_18260         CDS       T00711                                 

Gene name
aroH
Definition
(GenBank) Phospho-2-dehydro-3-deoxyheptonate aldolase, Trp-sensitive
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
eta01130  Biosynthesis of antibiotics
eta01230  Biosynthesis of amino acids
eta02024  Quorum sensing
Module
eta_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:eta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETA_18260 (aroH)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETA_18260 (aroH)
Enzymes [BR:eta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     ETA_18260 (aroH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: CAO96872
UniProt: B2VK02
LinkDB All DBs
Position
2075139..2076185
Genome map
AA seq 348 aa AA seqDB search
MNKTDELRTARIESLVTPAELQERFPIDAAIADNVTTSRKRITRILNGEDPRLLVVVGPC
SLHDPVAALEYAERLCTLREKYHSRIEIVMRTYFEKPRTVVGWKGMISDPDLDGSFRLNH
GLAVARKLLLDINALGMPTATEFLDVVTGQFIADLISWGAIGARTTESQIHREMASALSC
PVGFKNGTDGNIRIAVDAIRAARVSHMFLSPDKRGQMTIYQTSGNPAGHIIMRGGKTPNY
HAEDIAAAADCLREFHLPPRLVIDFSHGNCLKQHRRQKEVAADVAQQIRNGCQAIAGVMF
ESFLQEGTQKVQPGIPLLYGQSITDPCLGWQDSAEVLQQLADAVDSRF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaactgatgaactgcggaccgcacgcattgagagcctggttacgccggctgaa
ttgcaggagaggttcccgatcgatgcggccattgccgataacgtgacaacgtcacgaaaa
cgtattacccgtattcttaatggcgaagatccgcgcctgctggttgtggttggcccctgc
tctctacatgacccggtggcggcgctggaatatgctgagcggttatgcacactgcgcgaa
aaataccattcacgtattgaaatcgtcatgcgcacctattttgaaaaaccgcgcacggtc
gtgggctggaagggaatgatttcagatccggatctcgacggcagcttccgcctcaatcat
ggtctggccgtggcgcgtaaactcctgctggacatcaatgcgctcggtatgcccaccgcc
actgaatttctcgatgtggtgaccggacagtttattgccgacctgatcagctggggggca
attggtgcgcgcacgacggaaagccagatccaccgtgaaatggcctcggcgctgtcctgc
ccggtgggctttaaaaatggcaccgacggcaatattcgcattgcggtggatgccattcgc
gccgcgcgtgtgagccatatgttcctttcaccagataaacgcggccagatgaccatttat
caaaccagcggaaatcctgcgggccatatcattatgcgcggcggcaagacgcccaattat
cacgcggaagatatcgccgcggccgcagactgcctgcgcgaatttcatttgcctccccgg
ctggttatcgacttcagccacggcaactgcctgaaacagcaccgccgacagaaagaagtc
gccgccgatgtggcgcagcaaatccgcaatggctgccaggcgattgccggcgtgatgttc
gaaagcttcctgcaggaaggcacccagaaagttcagcccggtatcccgctgctttacggt
cagtcaatcaccgatccctgcctgggttggcaagacagcgccgaggtgttgcagcagctc
gcggatgctgtagacagccgcttttaa

DBGET integrated database retrieval system