KEGG   Erwinia tasmaniensis: ETA_30080Help
Entry
ETA_30080         CDS       T00711                                 

Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00061  Fatty acid biosynthesis
eta00780  Biotin metabolism
eta01100  Metabolic pathways
eta01212  Fatty acid metabolism
Module
eta_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:eta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETA_30080
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ETA_30080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:eta01004]
    ETA_30080
Enzymes [BR:eta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     ETA_30080
Lipid biosynthesis proteins [BR:eta01004]
 Fatty acid synthase
  Component type
   ETA_30080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: CAO98054
UniProt: B2VCS6
LinkDB All DBs
Position
complement(3353389..3354645)
Genome map
AA seq 418 aa AA seqDB search
MKKLNNELKRVVVTGYGAVTPLGATAAESWQAIMDNRLGYRYVDKKALNINTHFLGLIDD
EPSQKGIPAVIRRRLPRFARLTLGAARQAMTMAFGDTPPQVFYHSLNCGAIMGTGWAGLD
ESYGAQAEFAATGVTSPFNCFFAMPSVTTAACSQFWGLNGYQNTVIAACATGTMVIGDAY
EVIRSGRAQMMLAGAGESLTSHCAVWNIDVLGALSKETSDPQRASCPFSAHRSGFVLSEG
AAVLCLEEREGALARGATILGEITGYANFSDAWDFTSPADNCLARVQTITQALRRADLEP
QQLDYINAHGTSTPLNDLNETQSLKMALGEAAYAIPVSSTKSYSGHLISAAGAFESIVCL
QAIGHGTMPATANYQQPDERCDLDYIVEGHRASDVRRTLNLSFGFGGANAALVLEKHS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctgaataacgaacttaaacgcgttgtcgtgaccgggtacggtgccgtgacg
ccgctgggcgcaacggctgccgaaagctggcaggcgatcatggataaccggctcggttac
cgctacgttgataaaaaggcgctcaatataaacacccattttctcgggctaatcgatgac
gagccgagccagaaagggatacctgccgttatccgccgtcgcctgccgcgctttgcgcgc
ttgacgctgggtgccgcgcggcaggcgatgacgatggcctttggcgatacgccgccgcag
gtgttttatcactcgctaaactgtggcgcgatcatgggaaccggctgggcagggcttgat
gaaagctacggtgcgcaggccgaatttgccgccaccggagtgacttcgccatttaactgt
ttcttcgcgatgcccagcgtaaccactgccgcctgtagccagttctgggggttgaatggc
tatcagaataccgttatcgccgcctgcgctaccggtacgatggtgatcggcgatgcttat
gaagtgatccgcagcggcagagcacaaatgatgttggcaggtgccggcgaatcgctgacc
agccactgtgcggtatggaacattgacgtgctgggcgcgctgagcaaggagacatcggat
ccgcagcgagccagctgcccgttcagcgcgcatcgcagcggatttgtgctctctgaaggc
gcggcggtgctctgcctggaagagcgggaaggtgcgctggcgcgcggggcaaccattctt
ggtgaaatcaccggatacgccaacttctctgatgcctgggactttacctcgccggcggat
aattgcctggcccgcgttcagaccatcacccaggctttgcgccgggcggacctggagcca
cagcagctggactatatcaatgctcatggcacctcgacgccgcttaacgatcttaacgaa
actcagtcgctgaaaatggcgctgggcgaggcggcgtacgcgatccccgtctccagcacc
aagtcgtattctggtcacctgatctcggcggcaggtgcctttgaaagtattgtctgcctg
caggcgatcggtcatgggacgatgcccgccacggcaaactaccagcagcctgacgaacgg
tgcgatcttgattatatcgtcgaagggcaccgtgccagcgacgtcaggcgtacgctcaac
ctgagcttcggtttcggcggtgccaatgcggcgttggttctggagaagcactcatga

DBGET integrated database retrieval system