KEGG   Edwardsiella piscicida C07-087: ETAC_01035Help
Entry
ETAC_01035        CDS       T02509                                 

Definition
(GenBank) Superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
etc  Edwardsiella piscicida C07-087
Brite
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ETAC_01035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AGH72340
LinkDB All DBs
Position
250988..251515
Genome map
AA seq 175 aa AA seqDB search
MKKMKILVLATALMSGAAYSASESITLYEAGPQGAGPAIGEVTVSETPYGLLFTPSLHGL
PQGIHGFHVHENASCLPGVKEGKPVPALMAGGHWDPEKRGKHMGPYSDAGHLGDLPGLVV
NADGTANYAVLAPRLKSLSQLKGHALMVHVGGDNYDDHPHALGGGGARMACGVIQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgaaaatattggtactggccaccgcgttgatgagcggggctgcctacagc
gcctctgagtcgataacgctgtatgaagcggggccgcagggggcggggccggcgatcggt
gaggtgacggtcagcgaaacgccctatggtctgctgtttacgcccagcctgcacggtctt
ccgcaggggatccacggttttcatgtccatgaaaacgccagctgcctgccgggcgtcaaa
gagggtaaaccggtgccggccctgatggccggtggccactgggatcccgagaagcgcggt
aagcatatggggccctacagcgatgccgggcacctgggcgatctgccgggactggtggtc
aatgcggacggtacggcaaactatgccgtgctggcgccgcgtttgaaatcgctctcccag
ctgaagggacatgcgctgatggtgcacgtcggcggcgataactatgacgatcatccgcac
gcgctgggcggcggcggggcgcgtatggcctgcggcgttattcagtaa

DBGET integrated database retrieval system