KEGG   Edwardsiella piscicida C07-087: ETAC_02625Help
Entry
ETAC_02625        CDS       T02509                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K06020  energy-dependent translational throttle protein EttA
Organism
etc  Edwardsiella piscicida C07-087
Brite
KEGG Orthology (KO) [BR:etc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:etc03016]
    ETAC_02625
Transfer RNA biogenesis [BR:etc03016]
 Prokaryotic type
  tRNA transport factors
   tRNA export factors
    ETAC_02625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_tran_Xtn SMC_N MMR_HSR1 AAA_23 AAA_29 RsgA_GTPase AAA_18 AAA_22 AAA_27 Roc ATP-synt_ab AAA_13 NB-ARC RecA HAUS4 MRP-L46
Motif
Other DBs
NCBI-ProteinID: AGH72658
LinkDB All DBs
Position
complement(596105..597772)
Genome map
AA seq 555 aa AA seqDB search
MAQYVYTMNRVGKIVPPKRHILKDISLSFFPGAKIGVLGLNGAGKSTLLRIMAGVDTDIE
GEARPQPGIKIGYLPQEPKLNLEQTVREAVEEAVGDVKQALTRLDEVYALYADPDADFDK
LAKEQGELEAIIQSHDGHNLDNQLERAADALRLPAWDAKIANLSGGERRRVAICRLLLEK
PDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHDRYFLDNVAGWILELDRGEGIPW
EGNYSSWLEQKDQRLAQEASAEAARRKSIEKELEWVRQGAKGRQSKGKARLARFEELNNT
DYQKRNETSELFIPPGPRLGDKVLEVSNLSKSYGDRLLIDALSFSIPKGAIVGIIGPNGA
GKSTLFRMISGQEQADSGSITLGDTVTLASVDQFRDAMDDKKSVWEEISGGQDIMRIGNF
EIASRAYVGRFNFKGTDQGKRVGELSGGERGRLHLAKLLQVGGNMLLLDEPTNDLDVETL
RALENALLEFPGCAMVISHDRWFLDRIATHILDYQDEGRVEFFEGNFSEYEEYKKRTQGA
EALQPHRIKYKKIAK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaatacgtctataccatgaaccgcgtcggcaaaatcgtcccgccgaagcgtcac
atcctgaaagatatttccctcagtttcttcccgggtgccaaaatcggcgtgctgggttta
aacggcgcggggaaatccaccctgctgcgcattatggccggcgttgacaccgatatcgaa
ggcgaggcgcgcccgcagccggggattaagatcggctacctgccgcaggagccgaagctc
aatctggagcagaccgtccgcgaggcggtggaagaggccgtgggcgacgttaagcaggcg
ctgactcgcctggatgaggtgtacgccctgtacgccgatccggacgccgactttgacaag
ctggccaaagagcagggtgagctggaggcgatcattcagtctcacgatggccacaatctg
gataaccagctggagcgcgccgccgacgcgctgcgcctgccggcctgggatgccaagatc
gccaatctttccggcggtgagcgtcgccgtgtggctatctgccgtctgctgctggaaaaa
ccggatatgctgctgctcgacgagccgaccaaccacttggacgccgaatccgtcgcctgg
ctggagcgcttcctccacgactatgaaggcaccgtcgtcgccatcacccacgaccgctac
ttcctggacaacgtcgccggctggatcctcgaactggaccgcggcgaggggatcccgtgg
gagggcaactattcctcctggcttgagcaaaaggatcagcgtctggcgcaggaggcctct
gctgaagccgcccgccgtaaatccattgagaaagagctggagtgggtgcgtcagggcgcc
aagggccgtcagtcaaagggcaaagcccgtctggcccgctttgaagagctcaacaatacc
gactatcaaaagcgtaacgaaaccagcgagctgttcattccgccgggaccacgcctgggc
gacaaagtgctggaggtcagcaacctgtccaaatcctacggcgatcgcctgctgatcgat
gcgctctcattcagcatcccgaaaggggctatcgtcggcatcatcggcccgaacggcgcc
ggtaagtccaccctgttccgcatgatctccgggcaagaacaggcggatagcggcagcatc
acgctgggcgacaccgtgaccctggcctccgtcgatcagttccgcgacgccatggacgat
aagaaaagcgtctgggaagagatctccggtgggcaggacatcatgcgtatcggtaacttt
gagatcgccagccgcgcctatgtcggtcgcttcaactttaaaggcaccgatcagggcaaa
cgcgtcggcgaactctccggtggggagcgtggccgtctgcatctggccaagctgctgcag
gtcggcggcaatatgctgctgctcgacgaaccgaccaacgatctggacgttgaaaccctg
cgcgcgctggaaaacgccctgctggagttcccgggctgcgctatggtcatctcccatgac
cgctggttcctcgaccgtatcgcaacccatatcctcgactatcaggatgaggggcgcgtc
gaattcttcgaaggtaacttcagcgagtacgaagagtacaagaagcgcacccagggcgcc
gaagccctgcagccgcaccgtatcaagtacaagaagatcgccaaataa

DBGET integrated database retrieval system