KEGG   Edwardsiella piscicida C07-087: ETAC_03710Help
Entry
ETAC_03710        CDS       T02509                                 

Definition
(GenBank) 4Fe-4S ferredoxin
Organism
etc  Edwardsiella piscicida C07-087
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_9 Fer4_2 Fer4_21 Fer4_10 GF_recep_IV Fer4_6 Fer4_16 Fer4_4 Fer4_8 Fer4_3 Fer4_17 Fer4_20
Motif
Other DBs
NCBI-ProteinID: AGH72873
LinkDB All DBs
Position
complement(855450..855710)
Genome map
AA seq 86 aa AA seqDB search
MALLITKKCINCDMCEPECPNQAISMGEQIYQIDPARCTECVGHYDEPTCMKVCPIDNTI
IRDPAHAESEEQLWDKFVRLYHSDVL
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggcgttactgattaccaagaagtgcatcaactgcgacatgtgcgaaccggagtgcccc
aatcaggcgatctcgatgggggagcaaatttaccagatcgatccggcgcgctgcaccgaa
tgcgtcggtcactacgacgagccgacctgtatgaaggtctgcccgatcgataacactatc
atccgcgatccggcgcacgccgaaagcgaagagcagctgtgggacaagtttgtgcgactg
taccacagcgacgtcctgtaa

DBGET integrated database retrieval system