KEGG   Edwardsiella piscicida C07-087: ETAC_05970
Entry
ETAC_05970        CDS       T02509                                 

Gene name
rlmL
Definition
(GenBank) 23S rRNA m(2)G2445 methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
etc  Edwardsiella piscicida C07-087
Brite
KEGG Orthology (KO) [BR:etc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:etc03009]
    ETAC_05970 (rlmL)
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     ETAC_05970 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     ETAC_05970 (rlmL)
Ribosome biogenesis [BR:etc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ETAC_05970 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_15 Methyltransf_24 N6_Mtase Spermine_synth
Other DBs
NCBI-ProteinID: AGH73319
LinkDB
Position
1374421..1376538
AA seq 705 aa
MKSLFASTARGLEELLKNELEGLGAHDCQIVQGGVHFRGDGRLLYQSLMWSRLASRIMLP
LGEFKVYSDLDLYLGVQAIDWPTLFGIDKTFAVHFSGTNEEIRNTQYGALKVKDAIVDRF
TRSIDARPSVAKQDPDIRISVYLQRETAIVSLDLSGDGLHQRGYRDLTGQAPLKETLAAA
VVLRSGWQPGTPMVDPMCGSGTLLIEAAMMASDRAPGLQRERWGFMGWLGHNADLWQEVR
VEAQRRARLGLEQTTSRFFGYDLDRRVLEMARANARRAGVAALITFNGGDVAQLHNPLPE
GPQGTVLSNPPYGERLESEPALIALHNTLGRIMKREFGGWQLSLFSASPELLSCLQLRAE
RQFKAKNGPLECVQKNYRLSAAPQAGGGEVAQDYANRLRKNLKKFDKWARQEGLTCYRVY
DADLPEYNVAVDRYGEKIVVQEYAPPKSVDAQKARQRLFDVVSVTQSVMGVSGNNLILKT
RERQKGKSQYEKLAQKGEFMEVHEYGARFWVNLTDYLDSGLFIDHRIARRMLGEMSRGKD
FLNLFAYTGSASVYAGLGGARSTTTVDMSRTYLEWAERNLRLNGLTGRQHRLVQADCLSY
LHHCEDKFDLIFIDPPTFSNSKRMEGTFDVQRDHLDLMRDLARILRRGGTIMFSNNKRGF
KMDLAGLAQLGLQAQEITERTLSADFARNRQIHNCWLVTHAGEEQ
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgaaatctctttttgccagcaccgcgcgcggtctcgaagaactactgaaaaatgaactg
gaagggctcggtgcgcatgactgccagattgtccagggtggcgtgcatttcaggggagat
gggcgtttgctctatcagagtctgatgtggagccgtctggcgtcgcgcatcatgctgccg
ctgggtgagtttaaggtttacagcgatctggatctgtacctgggcgtacaggcgatcgat
tggccgacgctgtttggcatcgataagacctttgcggtgcacttcagcggcaccaatgag
gagatccgcaatacccagtatggcgccctcaaggtgaaggatgccatcgttgaccgcttt
acgcggagcatcgatgcgcgtcccagcgtggccaagcaggatcccgatattcgcatcagc
gtctatctgcagcgcgaaacggcgatcgtatcgctggatctcagcggcgatgggctgcat
cagcgcggctatcgcgatttgactggccaggcgccgctgaaggagacgctggcggcggcc
gtggtgctgcgctccggctggcagccgggtacgccgatggtcgacccgatgtgcggttcc
ggcacgctgctgatcgaggcggcgatgatggcatccgatcgggcgccggggctgcagcgt
gagcgctggggctttatgggctggctcggtcacaacgccgatctgtggcaggaggtacgc
gtagaggcgcagcgccgcgcccgtttggggctggagcagacgacctcgcgcttctttggc
tacgatctcgatcgccgcgtgctggagatggcgcgcgctaacgcccgtcgcgccggggtg
gccgccctgatcacctttaacggtggcgatgtggctcagctgcacaatccgctgccggaa
gggccgcaggggacggtgctgagcaacccgccctatggggagcgactggagagcgaaccg
gcgctgatcgcgctgcacaacacgctggggcgcatcatgaagcgggagttcggtggttgg
cagctgtcgctgttcagcgcctcgccggagctgttgagctgtctgcagctgcgcgccgag
cgccagtttaaggcgaagaatggcccgctggagtgtgtccagaagaactaccgcctgagc
gcggcaccgcaggccggcggcggcgaggtggcgcaggactatgccaaccgtctgcgtaag
aacctgaaaaagtttgataagtgggcgcggcaagaggggctgacgtgctaccgagtctac
gatgccgatctgccagagtacaacgtggcggttgaccgctacggggaaaagatcgtggtc
caggagtatgcgccgccgaagagcgtcgatgcgcagaaggcgcgccagcgtctatttgac
gtggtcagcgtgacccagtcggtgatgggcgtttcaggcaataatctgatcctgaaaacc
cgtgagcggcagaagggaaaaagccagtatgagaagctggcgcagaagggcgaattcatg
gaggtccatgagtacggtgcccgtttctgggtcaacctgaccgactatctggacagcggg
ctgtttatcgaccaccgcattgcgcgtcggatgctgggcgagatgagccgcggtaaggac
ttcctgaacctcttcgcctataccggcagcgccagcgtgtacgccgggctgggcggcgcg
cgttcgaccaccacggtcgatatgtcccgaacctatctggagtgggcggagcgcaacctg
cgtctgaatgggctgactgggcgtcagcatcgcctggttcaggcggactgcctgagctat
ctgcaccactgcgaggataagttcgatctgatctttatcgatccgccgaccttttccaac
tcgaagcggatggaggggacctttgatgtgcagcgcgatcacctggatctgatgcgcgat
ctggctcggatactgcgtcggggcggcactatcatgttctccaacaacaaacgcggtttc
aaaatggatctggccgggctggcgcagctgggcctgcaggcgcaggagatcaccgagcgc
acgctctctgccgactttgcccgtaaccgccagatccacaattgctggctggtgacccac
gccggcgaggagcagtaa

DBGET integrated database retrieval system