KEGG   Edwardsiella piscicida C07-087: ETAC_12415Help
Entry
ETAC_12415        CDS       T02509                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00310  Lysine degradation
etc00380  Tryptophan metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_12415
  09105 Amino acid metabolism
   00310 Lysine degradation
    ETAC_12415
   00380 Tryptophan metabolism
    ETAC_12415
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ETAC_12415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: AGH74604
LinkDB All DBs
Position
complement(2794710..2795921)
Genome map
AA seq 403 aa AA seqDB search
MSSVEILVPDLPESVADATVATWHKQVGDSIARDEVIVEIETDKVVLEVPAAEAGVLEAI
LEPEGATVTARQLLGRLRPADVSGVAISAGAQAAQATPAERHTAALETGSSDALSPAVRR
LVAEHDVDPSSLQGSGVGGRLTREDVTKHLAGQPSAAPVAAPPQAAAPLSAEREKRVPMT
RLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRSQYGEAFEKRHGVRLGFMSFYIKAV
LEALKRYPEVNAALDGEEVVYHNYFDISIAVSTPRGLVTPVIRDVDTLSMADIEKQIKAL
ALKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGQV
VILPMMYLALSYDHRQIDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgtagaaattctggttcccgatctgcctgaatccgtcgccgacgccacggtc
gctacctggcataagcaggtgggcgacagcatcgctcgcgatgaggtcatcgtcgagatc
gagacggacaaagtggtcctggaggtgccggcggcggaggccggcgtgttggaggctatt
ctggaaccggagggagcaacggtaacggcgcgccagctgctgggacggctgcgtccggcc
gacgtgagcggcgtcgcgattagcgccggtgcgcaggcggcgcaggcgacgccggccgag
cgccataccgccgccctggagacgggcagcagcgatgccctgagccccgcggtgcgtcgt
ctggtcgccgagcacgacgtggatccgtcgtcgctgcagggcagcggcgtcggcgggcgt
ctgacgcgagaggatgtgaccaagcatctggctgggcagccgagcgcggcgccggtcgcc
gcgccgcctcaggccgccgcgccgctgagcgcggagcgtgagaagcgggtgcccatgacc
cgtctgcgcaagcgggtggccgaacgcctgctggaggcgaagaacagcaccgcgatgctg
accacctttaacgaagtgaacatgaagccgatcatggatctgcgcagccagtacggtgag
gcgtttgaaaaacgccacggcgtgcgcctgggctttatgtctttttatatcaaggcggta
ttggaagcgctgaagcgttatccggaggtgaacgccgcccttgacggcgaagaggtggtc
taccataactacttcgatatcagcattgcggtgtcgacgccgcgcgggctggtgacgccg
gtgatccgcgatgtcgataccctgagcatggcggatattgaaaaacagattaaggcgctg
gcgctgaaggggcgcgacggcaagctgacggtcgaggagctgaccggcggcaactttacc
attaccaacggcggcgtatttggctccctgatgtccacgccgattatcaacccgccgcag
agcgcgatcctgggcatgcatgccatcaaggatcgcccgatggcggtcgacggccaggtg
gtgatcctgccgatgatgtacctggcgctttcgtatgaccatcgtcagattgacgggcgt
gagtccgtgggcttcctggtgacggtcaaagagatgttggaagatccggcgcgtctgctg
ctggatgtgtaa

DBGET integrated database retrieval system