KEGG   Edwardsiella piscicida C07-087: ETAC_13800Help
Entry
ETAC_13800        CDS       T02509                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc00250  Alanine, aspartate and glutamate metabolism
etc00471  D-Glutamine and D-glutamate metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_13800
   00220 Arginine biosynthesis
    ETAC_13800
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ETAC_13800
Enzymes [BR:etc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ETAC_13800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AGH74881
LinkDB All DBs
Position
complement(3108300..3109235)
Genome map
AA seq 311 aa AA seqDB search
MTLDAQRLQQAVDAAHAQYATLAGGKNADYIPYLASVPSQLAAVAVVTRDGAVYCAGDSD
YRFALESISKVCTLALALEDVGPEAVQEKIGADPTGLPFNSVMALELHGGKPLSPLVNAG
AMASASLIKADNREQRWQRILAIQQQLAGETVALSDEVNQSEQTTNFHNRAIAWLLYSAG
TMYCDPMEACDVYTRQCSTLIDTVELATLGATLAAGGVNPRSGRRVLQADNVPYILAEMT
MEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEAGNSVRGQKMVADV
AARLGYNLYKA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacgttagatgcacagagattgcagcaggccgtcgatgcggcccatgcacagtatgcg
acgctggccgggggaaaaaacgcggactacatcccctatctggccagcgtgccgagccag
ctggcggcggtggcggtggtcacgcgcgacggcgcggtgtactgcgccggcgacagcgac
taccgtttcgccctggagtcgatctccaaggtgtgtaccctggcgctggcgctggaggac
gtggggcccgaggcggtgcaggaaaagatcggcgccgacccgactggtctgccgttcaac
tcggtgatggcgctggagctacacggtggcaagccgctgtcaccgctggtcaatgcgggg
gccatggcctcggctagcctgattaaggccgacaaccgtgagcagcgctggcagcgtatt
ttggccattcagcagcagctggccggcgagacggtggcgctgtcggacgaggtgaaccag
tcggagcagaccaccaactttcacaaccgcgccatcgcctggctactctattcggccggc
accatgtactgcgatccgatggaggcctgcgacgtgtatacccgtcagtgctccacgctc
attgataccgttgagctggcgacgctgggcgccacgctggcggcgggcggggtcaatccg
cgcagcgggcggcgggtgctgcaggccgacaacgtgccctacattctggcggaaatgacc
atggaggggctgtacggacgatccggcgactgggcctaccgcgtcggtctgccgggcaag
agcggggtcggcggtgggatcctggccgtggtgccgggggtgatgggcatcgcggccttt
tctccgccgctggatgaggcgggtaacagcgtccgcgggcaaaaaatggtggcggacgtc
gccgcacggctgggctataacctgtataaggcctaa

DBGET integrated database retrieval system