KEGG   Edwardsiella piscicida C07-087: ETAC_13810Help
Entry
ETAC_13810        CDS       T02509                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00250  Alanine, aspartate and glutamate metabolism
etc00410  beta-Alanine metabolism
etc00430  Taurine and hypotaurine metabolism
etc00650  Butanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ETAC_13810
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_13810
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ETAC_13810
   00430 Taurine and hypotaurine metabolism
    ETAC_13810
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_13810
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ETAC_13810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Arabinose_Iso_C PRTase_3
Motif
Other DBs
NCBI-ProteinID: AGH74883
LinkDB All DBs
Position
complement(3110928..3112220)
Genome map
AA seq 430 aa AA seqDB search
MREDIAFQVINDELFLDGNARQNLATFCQTWDDDYVHRLMDISINKNWIDKEEYPQSAAI
DLRCVNMVADLWHAPRPADGQAVGTNTIGSSEACMLGGMAMKWRWRAKRLAQGKSVDKPN
MVCGPVQVCWHKFARYWDVELREIPMAPGKLFMDPERMIAACDENTIGVVPTFGVTYTGN
YEMPDVLHKALDDLQARTGLDIDMHVDAASGGFLAPFCAPDIVWDFRLPRVKSISASGHK
FGLAPLGCGWVVWRDAASLPDDLIFKVDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGR
EGYTKVHTASYQVAQFLAAEIAKLGPYEFICSGDPQQGIPAVCFRIPAGKALGYSLYDLS
ERLRLRGWQVPAFALNGEMSDVVVMRIMCRRGFEMDFAQLLMEDFRAALAYLKAHPAVAN
VAHQNSFKHS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagacattgctttccaggttattaacgatgagctgtttttagacggcaatgcc
cggcaaaacctggcgacgttttgtcagacctgggatgacgactatgtacaccgcctgatg
gatatttcgatcaataaaaactggatcgataaagaggagtatccgcagtcggcggcgatc
gatctgcgctgcgtcaatatggtggccgatctgtggcatgcgccgcgcccggcggatgga
caggccgtcggtaccaatactatcggctcctccgaggcctgcatgctgggcggcatggcg
atgaagtggcgctggcgcgccaagcgtctggcgcagggaaaatcggtggataagcccaac
atggtgtgcgggccggtacaggtctgctggcataagtttgcccgctactgggatgtcgaa
ctgcgcgagatcccgatggcgcccggcaagctgtttatggatccggagcggatgatcgcc
gcctgcgatgagaacaccatcggcgtcgtgccgacctttggcgtcacctacaccggtaac
tatgagatgcctgacgtgctgcacaaggcgctggacgatctgcaggcgcgtaccgggctg
gatatcgacatgcacgtcgacgccgccagcggcggcttcctggcaccgttctgcgccccg
gatatcgtctgggacttccgtctgccgcgggtgaaatccatcagcgcatccggccataag
ttcggcctggcaccgctcggctgcggctgggtggtgtggcgtgacgccgcctctttaccg
gacgatctgatctttaaggtggactatctgggcggacaggttggcacctttgccattaac
ttctcccgtcccgcgggtcaggtgatcgcgcagtactatgaattcctgcgtctgggacgc
gagggctacaccaaggtgcataccgccagctatcaggtggcgcagttcctggcggcggag
atcgctaagctgggaccctatgagtttatctgcagcggcgatccgcagcagggtattccg
gcggtgtgcttccgcattccggctggcaaggcgctgggctatagcctgtacgatctctcc
gagcgcctgcgcctgcgcggctggcaggttccggcctttgcgttgaacggtgaaatgtcc
gacgtggtggtgatgcgcatcatgtgccgccgcggctttgagatggattttgcccagctg
ctgatggaggacttccgcgcggcgctggcctatcttaaggcccatccggcagtggccaat
gtggcgcatcagaacagcttcaaacattcctga

DBGET integrated database retrieval system