KEGG   Edwardsiella piscicida C07-087: ETAC_15940Help
Entry
ETAC_15940        CDS       T02509                                 

Definition
(GenBank) Formate dehydrogenase N beta subunit
  KO
K08349  formate dehydrogenase-N, beta subunit
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_15940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_21 Fer4_6 Fer4_2 Fer4 Fer4_17 Fer4_4 Fer4_16 Fer4_3 Fer4_20 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AGH75309
LinkDB All DBs
Position
3598307..3599260
Genome map
AA seq 317 aa AA seqDB search
MSLQSQDIIKRSATNSLTPPPNGRNHQEEVAKLIDVTTCVGCKACQVGCSEWNDIRDEVG
HCVGVYDNPADLSAKSWTVMRFSEVEENGKLEWLIRKDGCMHCADPGCLKACPSAGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFNVPRMNPEDKRVYKCTLCVDRVAVGQEPACVKTCP
TGAIHFGTKAAMKTLAAERISELQGRGFADAGLYDPPGVGGTHVMYVLHHADRPELYHGL
PKDPHIDTPITLWKDVLKPVAFAGFIATFIGLLYHYIAVGPNTEDEDDHDDTPRGNAGGQ
EHSQAQGHAEENHHEQK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaatcccaagacattattaagcgttcggccaccaattccctgacgccgccc
cccaacgggcgcaatcaccaggaggaagtggccaagcttatcgacgtaaccacctgcgtc
ggctgtaaggcctgccaggtgggctgttcagagtggaacgatatccgggatgaggtcgga
cactgcgtcggggtgtatgacaaccccgccgatctgagcgccaagtcctggacggtgatg
cgcttctcggaggtcgaagagaacggcaagctggagtggttgatccgtaaggatggctgc
atgcactgcgccgatccgggctgcctgaaggcctgcccgtcggcgggcgccatcatccag
tacgccaacggtatcgtcgactttcagtccgagcactgcatcggctgcggctactgcatc
gccggctgcccgttcaacgtgccgcgcatgaacccggaagacaagcgggtgtacaagtgc
accctgtgcgtcgaccgcgtcgccgtcggccaggagccggcctgcgtcaaaacctgcccg
accggcgccatccactttggcaccaaggcggcgatgaagacgctggcggccgagcgcatc
agcgaactgcaggggcgcggctttgccgatgccggtctgtacgatccgccgggcgtcggc
ggcacccacgtgatgtatgtgctgcaccacgccgacagacccgagctgtaccacgggctg
ccgaaggatccgcatatcgatacccccatcacgctgtggaaggatgtgctcaaaccggtc
gcctttgccggttttatcgctacctttatcgggctgctgtaccactacatcgccgtcggt
cccaatacggaggacgaagacgatcacgacgatacgccgcgggggaacgctggcgggcag
gagcatagccaggcgcaaggacatgcagaggagaatcaccatgagcaaaaataa

DBGET integrated database retrieval system