KEGG   Edwardsiella tarda FL6-60: ETAF_0215Help
Entry
ETAF_0215         CDS       T02091                                 

Definition
(GenBank) Superoxide dismutase Cu-Zn precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
etd  Edwardsiella tarda FL6-60
Brite
Enzymes [BR:etd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ETAF_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ADM40338
UniProt: A0A0H3DM14
LinkDB All DBs
Position
252237..252764
Genome map
AA seq 175 aa AA seqDB search
MKKMKILVLATALMSGAAYSASESITLYEAGPQGAGPAIGEVTVSETPYGLLFTPSLHGL
PQGIHGFHVHENASCLPGVKEGKPVPALMAGGHWDPEKRGKHMGPYSDAGHLGDLPGLVV
NADGTANYAVLAPRLKSLSQLKGHALMVHVGGDNYDDHPHALGGGGARMACGVIQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgaaaatattggtactggccaccgcgttgatgagcggggctgcctacagc
gcctctgagtcgataacgctgtatgaagcggggccgcagggggcggggccggcgatcggt
gaggtgacggtcagcgaaacgccctatggtctgctgtttacgcccagcctgcacggtctt
ccgcaggggatccacggttttcatgtccatgaaaacgccagctgcctgccgggcgtcaaa
gagggtaaaccggtgccggccctgatggccggtggccactgggatcccgagaagcgcggt
aagcatatggggccctacagcgatgccgggcacctgggcgatctgccgggactggtggtc
aatgcggacggtacggcaaactatgccgtgctggcgccgcgtttgaaatcgctctcccag
ctgaagggacatgcgctgatggtgcacgtcggcggcgataactatgacgatcatccgcac
gcgctgggcggcggcggggcgcgtatggcctgcggcgttattcagtaa

DBGET integrated database retrieval system