KEGG   Edwardsiella tarda FL6-60: ETAF_1376Help
Entry
ETAF_1376         CDS       T02091                                 

Gene name
yeaD
Definition
(GenBank) Aldose 1-epimerase family protein YeaD
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00010  Glycolysis / Gluconeogenesis
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
etd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAF_1376 (yeaD)
Enzymes [BR:etd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ETAF_1376 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADM41488
UniProt: A0A0H3DSN9
LinkDB All DBs
Position
complement(1588623..1589519)
Genome map
AA seq 298 aa AA seqDB search
MSQSMSEKIFSLPVERQITPYISLRQLDALPIVVVNHPRLRAAVALQGAHLLLWQPSGEK
PTLWLSPDSAFQPGEPIRGGVPICWPWFGPAQQEGYPAHGFARNLPWTLSAHDEDAQGVT
LTLTLKESDASRKYWPHDFSLTARYRLSDHCSMELEAYGDYRCQAALHTYFNIADINAVS
VSGLGEPYLDKVNGGAEAIQQGALTFSARTDRVYTAPEPFSVIHDRGFQRSIEIHHHHHS
DVVAWNPWREIAAAMADMPNDGYHTMVCVETARVSQPLQVSSGCPARLAATLRLRPQR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagagcatgtccgaaaagattttttccttaccggtcgaacgacagatcacccct
tacatcagcctgcgccagctggatgcgttgcccatcgtggtggtcaaccacccgcggctg
cgggccgccgtcgccctgcagggcgcccacctgctgctgtggcagcccagcggcgaaaaa
ccgacgctgtggctctcgccggactccgcctttcaaccgggcgaaccgatccgcggcggt
gtgcccatctgctggccctggtttggcccggcccagcaggagggctatccggcacacggc
ttcgcccgcaacctgccctggaccctcagcgcgcatgatgaagacgcgcagggcgtaacc
ctgaccctcaccctgaaagagagcgacgcctcgcgtaaatactggcctcatgactttagc
ctgacggcccgctatcgcctcagcgaccactgcagtatggagctcgaagcctatggcgac
taccgctgccaggccgcgctgcacacctacttcaatatcgccgatattaacgccgtctcc
gtctctgggctgggggaaccctatctggataaagtcaacggcggcgccgaggctatccag
cagggagcgctgaccttcagcgcgcgtaccgaccgcgtctataccgcgccggagccattc
agcgtcattcacgatcgcggcttccagcgcagcatcgagatccaccaccaccatcacagc
gacgtcgtcgcctggaacccgtggcgtgagattgccgctgccatggccgatatgcccaat
gacggctatcacactatggtgtgcgttgagaccgcccgcgtcagtcaaccgctgcaggtc
agcagcggctgccctgcccgcctggccgccacgctgcgcctgcgcccgcagcgctga

DBGET integrated database retrieval system