KEGG   Edwardsiella tarda FL6-60: ETAF_1515Help
Entry
ETAF_1515         CDS       T02091                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
etd  Edwardsiella tarda FL6-60
Brite
Enzymes [BR:etd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ETAF_1515 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADM41623
UniProt: A0A0H3DT77
LinkDB All DBs
Position
complement(1737148..1737726)
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAMNALEPHISAETLEYHYGKHHNAYVVNLNNLIKGTEFEGKSLEEIVKSA
SGGIFNNAAQVWNHTFYWHCLSPNGGGEPRGALADAINAAFGSFAAFKDALTKSAVGNFG
SGWTWLVKKADGTLAIVNTSNAATPLTGDDKPLLTVDVWEHAYYIDYRNARPVYLENFWA
LVNWEFVAQNLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgaattacctgcattaccgtacgccatgaatgcgctggaaccgcatatctcc
gccgaaacgctggaataccactacggtaagcaccacaacgcctatgtagtcaacctgaac
aacctgatcaaaggcactgagttcgaaggaaaatcgctggaagagatcgtgaagagcgcc
tccggcggtatctttaacaacgccgctcaggtgtggaaccacaccttctactggcactgc
ctctccccgaacggcggcggtgaaccgcgcggcgccctggcggacgccatcaacgccgcc
ttcggctcatttgccgcgttcaaagacgcgctgaccaagtctgccgtaggcaacttcggc
tccggctggacctggctggtgaaaaaggcggacggcaccctggccatcgtcaacacctct
aacgccgcgaccccgctgaccggcgacgacaagccgctgctgaccgtggacgtatgggaa
cacgcctactacatcgactaccgtaacgctcgcccggtgtacctggaaaacttctgggcg
ctggtgaactgggagttcgtcgcccagaatctggcgtaa

DBGET integrated database retrieval system