KEGG   Edwardsiella tarda FL6-60: ETAF_2604Help
Entry
ETAF_2604         CDS       T02091                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00650  Butanoate metabolism
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
etd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ETAF_2604
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAF_2604
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ETAF_2604
   00430 Taurine and hypotaurine metabolism
    ETAF_2604
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAF_2604
Enzymes [BR:etd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ETAF_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Arabinose_Iso_C PRTase_3
Motif
Other DBs
NCBI-ProteinID: ADM42706
UniProt: A0A0H3DT79
LinkDB All DBs
Position
complement(2963018..2964412)
Genome map
AA seq 464 aa AA seqDB search
MKKGTDTRGGYLDSRFGSEAIRTAAEAHHFPQGEMREDIAFQVINDELFLDGNARQNLAT
FCQTWDDDYVHRLMDISINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPRPADGQAVGTN
TIGSSEACMLGGMAMKWRWRAKRLAQGKSVDKPNMVCGPVQVCWHKFARYWDVELREIPM
APGKLFMDPERMIAACDENTIGVVPTFGVTYTGNYEMPDVLHKALDDLQARTGLDIDMHV
DAASGGFLAPFCAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVVWRDAASLPDDLIFK
VDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVHTASYQVAQFLAAEIAKLGP
YEFICSGDPQQGIPAVCFRIPAGKALGYSLYDLSERLRLRGWQVPAFALNGEMSDVVVMR
IMCRRGFEMDFAQLLMEDFRAALAYLKAHPAVANVAHQNSFKHS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtactgatacccgtgggggatatttggattcccgctttggttcagaggct
attcgcacggcggcagaggcacaccattttcctcagggagaaatgcgcgaagacattgct
ttccaggttattaacgatgagctgtttttagacggcaatgcccggcaaaacctggcgacg
ttttgtcagacctgggatgacgactatgtacaccgcctgatggatatttcgatcaataaa
aactggatcgataaagaggagtatccgcagtcggcggcgatcgatctgcgctgcgtcaat
atggtggccgatctgtggcatgcgccgcgcccggcggatggacaggccgtcggtaccaat
actatcggctcctccgaggcctgcatgctgggcggcatggcgatgaagtggcgctggcgc
gccaagcgtctggcgcagggaaaatcggtggataagcccaacatggtgtgcgggccggta
caggtctgctggcataagtttgcccgctactgggatgtcgaactgcgcgagatcccgatg
gcgcccggcaagctgtttatggatccggagcggatgatcgccgcctgcgatgagaacacc
atcggcgtcgtgccgacctttggcgttacctacaccggtaactatgagatgcctgacgtg
ctgcacaaggcgctggacgatctgcaggcgcgtaccgggctggatatcgacatgcacgtc
gacgccgccagcggcggcttcctggcaccgttctgcgccccggatatcgtctgggacttc
cgtctgccgcgggtgaaatccatcagcgcatccggccataagttcggcctggcgccgctc
ggctgcggctgggtggtgtggcgtgacgccgcctctttaccggacgatctgatctttaag
gtggactatctgggcggacaggttggcacctttgccattaacttctcccgtcccgcgggt
caggtgatcgcgcagtactatgaattcctgcgtctgggacgcgagggctacaccaaggtg
cataccgccagctatcaggtggcgcagttcctggcggcggagatcgctaagctgggaccc
tatgagtttatctgcagcggcgatccgcagcagggtattccggcggtgtgcttccgcatt
ccggctggcaaggcgctgggctatagcctgtacgatctctccgagcgcctgcgcctgcgc
ggctggcaggttccggcctttgcgttgaacggtgaaatgtccgacgtggtggtgatgcgc
atcatgtgccgccgcggctttgagatggattttgcccagctgctgatggaggacttccgc
gcggcgctggcctatcttaaggcccatccggcagtggccaatgtggcgcatcagaacagc
ttcaaacattcctga

DBGET integrated database retrieval system