KEGG   Edwardsiella tarda FL6-60: ETAF_2604Help
Entry
ETAF_2604         CDS       T02091                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00250  Alanine, aspartate and glutamate metabolism
etd00410  beta-Alanine metabolism
etd00430  Taurine and hypotaurine metabolism
etd00650  Butanoate metabolism
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
etd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:etd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ETAF_2604
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAF_2604
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ETAF_2604
   00430 Taurine and hypotaurine metabolism
    ETAF_2604
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAF_2604
Enzymes [BR:etd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ETAF_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Arabinose_Iso_C PRTase_3
Motif
Other DBs
NCBI-ProteinID: ADM42706
UniProt: A0A0H3DT79
LinkDB All DBs
Position
complement(2963018..2964412)
Genome map
AA seq 464 aa AA seqDB search
MKKGTDTRGGYLDSRFGSEAIRTAAEAHHFPQGEMREDIAFQVINDELFLDGNARQNLAT
FCQTWDDDYVHRLMDISINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPRPADGQAVGTN
TIGSSEACMLGGMAMKWRWRAKRLAQGKSVDKPNMVCGPVQVCWHKFARYWDVELREIPM
APGKLFMDPERMIAACDENTIGVVPTFGVTYTGNYEMPDVLHKALDDLQARTGLDIDMHV
DAASGGFLAPFCAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVVWRDAASLPDDLIFK
VDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVHTASYQVAQFLAAEIAKLGP
YEFICSGDPQQGIPAVCFRIPAGKALGYSLYDLSERLRLRGWQVPAFALNGEMSDVVVMR
IMCRRGFEMDFAQLLMEDFRAALAYLKAHPAVANVAHQNSFKHS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtactgatacccgtgggggatatttggattcccgctttggttcagaggct
attcgcacggcggcagaggcacaccattttcctcagggagaaatgcgcgaagacattgct
ttccaggttattaacgatgagctgtttttagacggcaatgcccggcaaaacctggcgacg
ttttgtcagacctgggatgacgactatgtacaccgcctgatggatatttcgatcaataaa
aactggatcgataaagaggagtatccgcagtcggcggcgatcgatctgcgctgcgtcaat
atggtggccgatctgtggcatgcgccgcgcccggcggatggacaggccgtcggtaccaat
actatcggctcctccgaggcctgcatgctgggcggcatggcgatgaagtggcgctggcgc
gccaagcgtctggcgcagggaaaatcggtggataagcccaacatggtgtgcgggccggta
caggtctgctggcataagtttgcccgctactgggatgtcgaactgcgcgagatcccgatg
gcgcccggcaagctgtttatggatccggagcggatgatcgccgcctgcgatgagaacacc
atcggcgtcgtgccgacctttggcgttacctacaccggtaactatgagatgcctgacgtg
ctgcacaaggcgctggacgatctgcaggcgcgtaccgggctggatatcgacatgcacgtc
gacgccgccagcggcggcttcctggcaccgttctgcgccccggatatcgtctgggacttc
cgtctgccgcgggtgaaatccatcagcgcatccggccataagttcggcctggcgccgctc
ggctgcggctgggtggtgtggcgtgacgccgcctctttaccggacgatctgatctttaag
gtggactatctgggcggacaggttggcacctttgccattaacttctcccgtcccgcgggt
caggtgatcgcgcagtactatgaattcctgcgtctgggacgcgagggctacaccaaggtg
cataccgccagctatcaggtggcgcagttcctggcggcggagatcgctaagctgggaccc
tatgagtttatctgcagcggcgatccgcagcagggtattccggcggtgtgcttccgcatt
ccggctggcaaggcgctgggctatagcctgtacgatctctccgagcgcctgcgcctgcgc
ggctggcaggttccggcctttgcgttgaacggtgaaatgtccgacgtggtggtgatgcgc
atcatgtgccgccgcggctttgagatggattttgcccagctgctgatggaggacttccgc
gcggcgctggcctatcttaaggcccatccggcagtggccaatgtggcgcatcagaacagc
ttcaaacattcctga

DBGET integrated database retrieval system