KEGG   Edwardsiella tarda FL6-60: ETAF_3201Help
Entry
ETAF_3201         CDS       T02091                                 

Gene name
pstB
Definition
(GenBank) Phosphate transport ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:etd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAF_3201 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etd02000]
    ETAF_3201 (pstB)
Enzymes [BR:etd01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     ETAF_3201 (pstB)
Transporters [BR:etd02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    ETAF_3201 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_22 AAA_16 AAA_29 RsgA_GTPase Rad17 AAA_23 PRK AAA_30 PhoH AAA_33 Adeno_IVa2 ATPase_2 AAA_28 AAA_25 AAA_24 G-alpha RNA_helicase TniB AAA_5 AAA_7 AAA AAA_27 AAA_18
Motif
Other DBs
NCBI-ProteinID: ADM43304
UniProt: A0A0H3DVL6
LinkDB All DBs
Position
3670882..3671661
Genome map
AA seq 259 aa AA seqDB search
MSNVVTDPTNSKIQVRDLNFYYGKFHALKNISLDIEKNKVTAFIGPSGCGKSTLLRTFNK
MFQLYPEQRAEGDILLDGQNILTDSQDVALLRAKVGMVFQKPTPFPMSIYDNIAFGVRLF
EKLSRADMDERVQWALTKAALWSETKDKLHQSGYSLSGGQQQRLCIARGIAIRPEVLLLD
EPCSALDPISTSRIEELITELKQDYTVVIVTHNMQQAARCSDYTAFMYLGELIEFSDTDK
LFTAPAQRQTEDYITGRYG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgtagtgacagacccgaccaacagtaaaattcaggtgcgcgatctgaacttc
tattacggaaaattccacgcgctgaagaatatctcgctggatattgagaaaaacaaagtg
acggccttcatcggtccctccggctgcggtaagtcgacgctgctgcgtacctttaacaag
atgttccagctttacccggagcagcgcgcagagggggatattttactggatggtcagaat
atcctgaccgacagccaggatgtcgcgctgctgcgcgccaaggtggggatggtgtttcag
aagccgacgccgtttcccatgtccatctacgacaatatcgccttcggcgtacgcctgttt
gaaaagctgtcgcgggccgatatggatgagcgggtgcagtgggcgctgaccaaggcggcg
ctgtggagtgagacgaaagataagctgcaccaaagcggctatagcctgtctggcggccag
cagcagcgtctgtgtatcgcccgcggcattgctatccgtccggaggtcttactgctggat
gagccctgctctgcgctggaccctatttcgaccagccgtatcgaggagctgatcaccgag
ctgaagcaggactacaccgtggtgatcgtgacccacaacatgcagcaggcggcgcgctgt
tctgattacactgcatttatgtatcttggtgaactaattgaatttagtgatacagataag
ctgtttaccgcccctgcacagcggcagacggaagactatattaccggtcgctatggctga

DBGET integrated database retrieval system