KEGG   Edwardsiella anguillarum: ETEE_2003Help
Entry
ETEE_2003         CDS       T03245                                 

Definition
(GenBank) Superoxide dismutase [Cu-Zn] precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ete  Edwardsiella anguillarum
Brite
Enzymes [BR:ete01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ETEE_2003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AIJ08448
UniProt: A0A076LP95
LinkDB All DBs
Position
2022917..2023492
Genome map
AA seq 191 aa AA seqDB search
MKMECRDYKKQYGDNDMKKMKILVLATALMSGAAYSASESITLYEAGPQGAGPTIGEVTV
SETPYGLLFTPSLRGLPQGIHGFHVHENASCLPGVKEGKPVPALMAGGHWDPEKRGKHMG
PYSDAGHLGDLPGLVVNADGTANYAVLAPRLKSLAQLKGHALMVHVGGDNYDDHPHALGG
GGARMACGVIQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggagtgcagagattacaagaaacaatatggagataacgatatgaaaaaaatg
aaaatattggtactggccaccgcgttgatgagcggggctgcctacagcgcctctgagtcg
ataacgctgtatgaagcggggccgcagggggcgggaccgacgatcggtgaggtgacggtc
agcgaaacgccctatggcctgctgtttacgcccagcctgcgcggtctcccgcaggggatc
cacggttttcatgtccatgaaaacgccagctgcctgccgggtgtcaaagagggtaaaccg
gtgccggccctgatggccggtggtcactgggatcccgagaagcgcggtaagcatatgggg
ccctacagcgatgccgggcatctgggcgatctgccgggactggtggtcaatgcggacggt
acggcgaactatgccgtgctggcaccgcgtctgaaatcgctcgcccagctgaaggggcat
gcgctgatggtgcacgtcggcggcgataactatgacgatcatccgcacgcgctgggcggc
ggcggtgcgcgtatggcctgcggcgttattcagtaa

DBGET integrated database retrieval system