KEGG   Edwardsiella anguillarum: ETEE_2405Help
Entry
ETEE_2405         CDS       T03245                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
ete  Edwardsiella anguillarum
Pathway
ete00471  D-Glutamine and D-glutamate metabolism
ete00550  Peptidoglycan biosynthesis
ete01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ete00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ETEE_2405 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETEE_2405 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ete01011]
    ETEE_2405 (murC)
Enzymes [BR:ete01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     ETEE_2405 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:ete01011]
 Precursor biosynthesis
  Amino acid ligase
   ETEE_2405 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: AIJ08846
UniProt: A0A076LLT2
LinkDB All DBs
Position
2443250..2444725
Genome map
AA seq 491 aa AA seqDB search
MNKTVNTQQLAKLRTMVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDLAPNAV
TQQLSELGAQIYFNHRPENVRDASVVVVSTAIAADNPEIIAAREARIPVIRRAEMLAELM
RFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGTHARLGSSRYLIAEAD
ESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLPFYGRAVLCIDDPVI
RELLPRVGRQVTTYGFSQDADVRIEEYRQCGAQGTFFLCRQDRPRLAVTLNAPGRHNALN
AAAAAAVASEEGIDDEAILRALSGFQGTGRRFDFLGEFSLQHVNNKPGKVMLVDDYGHHP
TEVDATIKAARAGWPDRRLVMVFQPHRFTRTRDLYDDFANVLSQVDVLLMLDVYPAGEHP
IPGADSRSLCRTIRGRGKLDPVLVSEPATLAQTLAQFLQEGDLILTQGAGNIGRVARVLA
ECRLQPSAVTE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagacagtgaatactcaacagctcgctaaactgcgtaccatggtgccggagatg
cgccgtgtccggcacattcactttgtcggcatcggcggcgctggcatgggcggtattgca
gaggtgctggccaacgagggttatcagatcagcggctccgatctggcgcccaacgcggtg
acccagcaactgagcgagctgggcgcgcagatctattttaaccatcgcccggaaaacgta
cgcgatgccagcgttgtggtcgtatcgaccgcgatcgccgccgataacccggagattatc
gccgcccgcgaggcgcgtattccggtgatccgccgcgcggagatgctggcggagctgatg
cgtttccgccacggtatcgccattgccggaacccatggcaagaccaccaccacggcgatg
gtctccagtatttatgccgaggccgggctggacccgacctttgttaacggcggtctggtg
aaagcggccggcacacacgcccgcttgggttccagtcgctatctgatcgccgaggccgat
gagagcgatgcctcgtttttgcatctgcagccgatggtggcgatcgtcaccaatatcgaa
gccgatcatatggatacctatcacggcgatttcgaaaacctgaagcagacctttatcaac
tttctgcacaacctgccgttttatggccgggcggtgctgtgcatcgacgatccggtgatc
cgcgagctgctgccgcgcgtcgggcgccaggtgaccacctatggctttagccaggatgcc
gatgtccgcattgaggagtaccgccagtgcggcgcccagggaaccttcttcctgtgtcgt
caggatcgtccacgcctggcggtgaccctaaatgcaccaggtcgccacaatgctctgaat
gcggccgccgctgcggcggtagccagcgaagaggggatcgacgatgaggctatcctgcgc
gcgctgagcgggtttcagggcaccgggcgtcgctttgacttcctgggggagtttagcctg
cagcacgtcaacaataagccgggcaaggtgatgctggtggatgactatggacatcatccg
acggaggtagatgccaccattaaggccgcccgtgccggttggccggatcgccgcctggtg
atggttttccagccgcaccgctttacccgtacccgcgatctgtatgatgactttgccaac
gtattgtcacaggtagatgtcctgctgatgctggatgtgtatcctgccggcgagcatccg
atccccggcgcggatagccgctcgctgtgtcgcaccattcgcgggcgcggcaagctggac
ccggtgctggtgtcggagccggcgacgttggcgcagacgctggcgcagttcctgcaagag
ggtgacctgattctgacccagggcgccggtaatattggccgggtggcgcgggtgctggcg
gagtgccgcctgcagccgtccgcggtaacggagtaa

DBGET integrated database retrieval system