KEGG   Edwardsiella anguillarum: ETEE_2509Help
Entry
ETEE_2509         CDS       T03245                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ete  Edwardsiella anguillarum
Pathway
ete00061  Fatty acid biosynthesis
ete00780  Biotin metabolism
ete01100  Metabolic pathways
ete01212  Fatty acid metabolism
Module
ete_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ete00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETEE_2509 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ETEE_2509 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ete01004]
    ETEE_2509 (fabZ)
Enzymes [BR:ete01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ETEE_2509 (fabZ)
Lipid biosynthesis proteins [BR:ete01004]
 Fatty acid synthase
  Component type
   ETEE_2509 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: AIJ08948
UniProt: A0A076LQV0
LinkDB All DBs
Position
2557528..2558019
Genome map
AA seq 163 aa AA seqDB search
MLFDIRFYRKSILTTDTHTLNISEILELLPHRFPFLLVDRVLDYQEGKFLRAVKNVSFNE
PFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDDARFKRPVHPG
DQMILEVEFLKERRGVARFNGVAKVDGKIVCEASMMCARNREA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgttgtttgacatccgtttttacaggaagagtattttgactactgacactcatactctc
aatatttcagagattttagagcttctgccgcaccgttttccgttcctgctggtggatcgt
gtgctggattatcaagagggcaaattcctgcgtgcagtgaagaatgtctccttcaacgag
ccatttttccagggacacttcccgggcaagccgattttccccggggtgctgatcctcgaa
gccatggcgcaggccaccggtattctggcattcaagagcgtgggcaaactggagccgggc
gaactgtactacttcgccggtatcgatgacgcccgctttaagcgtccggttcatccgggt
gaccagatgatcctggaagtggagtttctgaaagagcgccgcggcgtggctcgctttaac
ggtgttgccaaggttgacggcaagatcgtgtgcgaggcgtccatgatgtgcgcccgtaac
cgtgaggcctga

DBGET integrated database retrieval system