KEGG   Edwardsiella anguillarum: ETEE_2698Help
Entry
ETEE_2698         CDS       T03245                                 

Definition
(GenBank) 3-oxoacyl-[ACP] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
ete  Edwardsiella anguillarum
Pathway
ete00061  Fatty acid biosynthesis
ete00780  Biotin metabolism
ete01100  Metabolic pathways
ete01130  Biosynthesis of antibiotics
ete01212  Fatty acid metabolism
Module
ete_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ete00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETEE_2698
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ETEE_2698
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ETEE_2698
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ete01004]
    ETEE_2698
Enzymes [BR:ete01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     ETEE_2698
Lipid biosynthesis proteins [BR:ete01004]
 Fatty acid synthase
  Component type
   ETEE_2698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase LDcluster4 Eno-Rase_NADH_b NAD_binding_10 ISP3_C
Motif
Other DBs
NCBI-ProteinID: AIJ09131
UniProt: A0A076LMN5
LinkDB All DBs
Position
complement(2738113..2738844)
Genome map
AA seq 243 aa AA seqDB search
MSRSVLVTGASKGIGRAIARQLAADGFTVGVHYHRDEAGAQETLAAIQQAGGSGRLLSFD
VGHREQCREVLEQEIARHGAWYGVVSNAGITRDGAFPALSDDDWDRVIHTNLDSFYNVIH
PCIMPMIGLRQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNC
IAPGLIETGMIAMEESALKEAMAMIPMKRMGQADEVAGLAGYLMSDIAGYVTRQVISING
GML
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgctcagtactggtcaccggggccagtaaaggaattggacgtgcgattgcccgt
cagcttgccgccgacggctttaccgtaggcgttcactaccaccgcgacgaagcgggagca
caagagaccctggccgccattcagcaggcgggcggcagcgggcgcctgctcagctttgac
gtcggccaccgcgagcagtgccgcgaggtgctggagcaggagatcgcccggcacggcgca
tggtacggcgtggtcagcaacgcgggcatcacccgcgacggcgcgtttccggccctgagt
gacgacgactgggaccgcgtgatccataccaacctcgacagcttttacaacgtcattcac
ccgtgcattatgccgatgatcggcctgcgccagggcgggcgtatcattaccctgtcgtcg
gtttccggcgtgatgggcaaccgtggccaggtgaactacagcgcggcgaaggcggggatc
atcggcgccaccaaagcgctggcaattgagctcgccaagcgcaaaatcaccgtcaactgt
atcgcgcccgggctgattgagaccgggatgatcgcgatggaggagagcgcgctgaaagag
gcgatggcgatgatcccgatgaaacgcatgggtcaggccgatgaggtggccgggcttgcc
ggctatttaatgtctgacattgcgggctacgtgacccgacaggtcatttccatcaacgga
ggaatgctatga

DBGET integrated database retrieval system