KEGG   Edwardsiella anguillarum: ETEE_3064Help
Entry
ETEE_3064         CDS       T03245                                 

Definition
(GenBank) Sorbitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
ete  Edwardsiella anguillarum
Brite
KEGG Orthology (KO) [BR:ete00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ETEE_3064
Enzymes [BR:ete01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     ETEE_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AIJ09493
UniProt: A0A076LSG3
LinkDB All DBs
Position
3085022..3086137
Genome map
AA seq 371 aa AA seqDB search
MSQCCGANAVTVREGIPATMQAVVAYAPHDYRLEEVAVPTIGEGEILVKVEACGICAGDT
KAFEGAASFWGDETQPAYIKAPMIPGHEFIGHVVGFGAGVVDFALGDRVIAEQIVPCWSC
RFCQRGQYWMCEKHDLYGFQSNVNGGMAEYMKFTPQSINYRVPDDLPMEKAILIEPYACS
FHAVQRAKIQLGDTVVLAGAGTLGLGMIGAIKKSGAGRLIVLDLSDERLALAQKFGADRV
LNPARDDVVSSVKTMTDGYGCDVYIEATGAAASVEQGLRMIRKLGTFVEFSVFKQPVSVD
WSIISDRKELDVLGSHLGPYCYPRVIEGIANGDLPTEGVVTHVLPLSQFAEGFALMQRGV
GSIKVVLNPNL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtgttgcggagcaaacgcggtaacggtgcgcgaggggatccctgcgacgatg
caggcggtggtggcgtatgccccccacgactaccgtttggaggaggtcgccgttccaacg
attggcgagggcgagatcttggtgaaggtggaggcctgcggtatctgcgccggtgacacg
aaagcctttgaaggggcggccagtttttggggggatgagacgcagccggcctacatcaaa
gcgcccatgatcccgggtcatgaatttatcggtcatgtcgttgggttcggcgctggcgtg
gtggattttgcgctaggcgatcgggttatcgcggagcagatcgtgccgtgctggtcctgc
cggttttgtcagcgcggtcagtactggatgtgtgagaagcacgacctgtatggctttcag
agcaacgtgaatggcggaatggcggagtatatgaaatttacgccgcagtccatcaattat
cgggtccccgacgatctgccgatggagaaagcgattctgattgagccctatgcctgttca
ttccacgcggtacagcgcgcgaagatccaactgggggatacggtggtattagccggcgcc
gggaccctggggttggggatgattggcgcgattaaaaagtcaggggcgggcaggctgatc
gttctggacctttccgatgagcgtttggccctcgcgcagaaatttggcgccgatcgggta
ctcaatccggcccgggatgacgtcgtatccagcgttaaaacgatgaccgacggatatggc
tgcgatgtgtatatcgaggcaacgggagccgcggcgtcggttgagcaagggttacggatg
atccgcaagctggggacattcgttgagttttcggtatttaagcaaccggtgagcgtggac
tggagcattatcagcgatcgtaaagagctggatgtgctggggtcacaccttggcccctat
tgctatccgcgggtgatcgagggaattgccaatggcgatttgcccaccgagggcgtagta
acgcatgtcctgccgctatcgcagtttgccgaggggtttgcactcatgcagcgcggcgtc
ggctcaattaaggttgtgcttaatccaaatctataa

DBGET integrated database retrieval system