KEGG   Edwardsiella anguillarum: ETEE_3721Help
Entry
ETEE_3721         CDS       T03245                                 

Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ete  Edwardsiella anguillarum
Brite
Enzymes [BR:ete01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ETEE_3721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIJ10133
UniProt: A0A076LUK0
LinkDB All DBs
Position
complement(3738285..3738863)
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAMNALEPHISAETLEYHYGKHHNAYVVNLNNLIKGTEFAGKSLEEIVKSA
SGGIFNNAAQVWNHTFYWHCLSPNGGGEPRGALADAINAAFGSFAAFKDALTKSAVGNFG
SGWTWLVKKADGTLAIVNTANAATPLTGDDKPLLTVDVWEHAYYIDYRNARPVYLENFWA
LVNWEFVAQNLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgaattacctgcattaccgtacgccatgaatgcgctggaaccgcatatctcc
gccgaaacgctggaataccactacggtaagcaccacaacgcctatgtggtcaacctgaat
aatctgatcaaaggcacggagttcgcagggaaatcgctggaagagatcgtgaagagcgcc
tccggcggtatctttaacaacgccgctcaggtgtggaaccacaccttctactggcactgt
ctctccccgaacggcggcggcgagccgcgcggcgccctggctgacgccatcaacgccgcc
ttcggctcatttgccgcgttcaaagacgcgttgaccaagtctgccgtcggcaacttcggc
tccggctggacctggctggtgaaaaaggcggacggcaccctggccatcgtcaacaccgct
aacgccgcgaccccgctgaccggcgacgacaagccgctgctgaccgtggacgtatgggag
cacgcctactacatcgactaccgtaacgctcgcccggtgtacctggaaaacttctgggcg
ctggtaaactgggagttcgtcgcccagaatctggcgtaa

DBGET integrated database retrieval system