KEGG   Edwardsiella anguillarum: ETEE_4055Help
Entry
ETEE_4055         CDS       T03245                                 

Gene name
cbiT
Definition
(GenBank) Cobalt-precorrin-6y C15-methyltransferase [decarboxylating]
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
ete  Edwardsiella anguillarum
Pathway
ete00860  Porphyrin and chlorophyll metabolism
ete01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ete00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ETEE_4055 (cbiT)
Enzymes [BR:ete01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     ETEE_4055 (cbiT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS PCMT Methyltransf_31 PrmA GidB Cons_hypoth95 Methyltransf_25 Methyltransf_4 Met_10 Methyltransf_12 Methyltransf_11 CMAS Methyltransf_2 Methyltransf_18 DOT1 Methyltransf_23 RrnaAD PRMT5 Methyltransf_15 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: AIJ10462
UniProt: A0A076LUW0
LinkDB All DBs
Position
complement(4066006..4066575)
Genome map
AA seq 189 aa AA seqDB search
MNDELFLRGETVPMTKEAVRALALSKLELHRASHLIDIGAGTGSVSIEAALQFPSLRVTA
IEKNPAALRLLEENRRRFACGNVRILPGSAPMPVAERADAVFMGGSGGHLTALMDWSMAQ
LHPGGRLVMTFILMENLHSALAHLAQRGAQGVTCQQIQTASWVPLGQGHYFKPNNPVFVI
ACQKEEHHV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgagctttttctgcgcggcgaaacggtgccgatgaccaaagaggcggtgcgc
gcgctggccctcagcaaacttgagctgcaccgtgccagccatctgatcgatatcggggcg
ggaaccggcagcgtatcgattgaggccgcgctgcagtttccctctctgcgggtgaccgcc
atcgagaaaaaccccgcggcgctgcgcctgctcgaagagaaccgccggcgctttgcctgc
ggcaacgtccgcatcctacccggcagcgcgccgatgccggtggcggagcgggccgacgcc
gtgtttatgggcggcagcggcggccatctgacggcgctgatggactggtcgatggcccag
ctgcatcccggcgggcgcctggtgatgacctttatcctgatggagaacctgcatagcgcg
ctggcccatctggcgcagcggggagcgcagggcgtgacgtgtcagcagatacagacggcg
tcgtgggttccgctcggtcagggccactactttaaaccgaataatcccgtttttgttatc
gcctgtcagaaggaggaacatcatgtctga

DBGET integrated database retrieval system