KEGG   Enterococcus thailandicus: CK496_00285Help
Entry
CK496_00285       CDS       T05312                                 

Definition
(GenBank) 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eth  Enterococcus thailandicus
Pathway
eth00010  Glycolysis / Gluconeogenesis
eth00260  Glycine, serine and threonine metabolism
eth00680  Methane metabolism
eth01100  Metabolic pathways
eth01110  Biosynthesis of secondary metabolites
eth01120  Microbial metabolism in diverse environments
eth01130  Biosynthesis of antibiotics
eth01200  Carbon metabolism
eth01230  Biosynthesis of amino acids
Module
eth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eth_M00002  Glycolysis, core module involving three-carbon compounds
eth_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CK496_00285
  09102 Energy metabolism
   00680 Methane metabolism
    CK496_00285
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CK496_00285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eth04131]
    CK496_00285
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eth04147]
    CK496_00285
Enzymes [BR:eth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CK496_00285
Membrane trafficking [BR:eth04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CK496_00285
Exosome [BR:eth04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CK496_00285
  Exosomal proteins of melanoma cells
   CK496_00285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ASZ06438
UniProt: A0A179ESN5
LinkDB All DBs
Position
complement(59054..59740)
Genome map
AA seq 228 aa AA seqDB search
MPKLVFSRHGLSEWNALNQFTGWADVNLAPEGIEEAKEGGRKIKEAGIEFDIAYTSVLTR
AIKTCNLILEYSDQLWVPQVKSWRLNERHYGKLQGLNKKETAEKYGDEQVHIWRRSYDTL
PPLLDETDEGSAANERRYAMLDKRDIPGGENLKVTLERALPFWQDHIAPALLDDKTVLVA
AHGNSLRALAKHIEGISDEDIMDLEIPTGQPLVYELNDDLTVAKKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagttttttctcgtcacggtcttagtgaatggaacgctttaaaccaattt
actggttgggctgatgtaaacttagcaccagaaggtatcgaagaagcaaaagaaggcgga
cgcaaaatcaaagaagctggaatcgaatttgatattgcttacacttctgttttaactcgt
gccatcaaaacttgtaaccttatcttagaatactcagatcaactttgggtacctcaagta
aaatcatggcgcttaaacgaacgtcattatggtaaattacaaggcttgaacaaaaaagaa
actgctgaaaaatatggtgatgaacaagttcatatttggcgccgttcttacgacactctt
cctccattattggacgaaactgacgaaggttcagctgcaaatgaacgtcgttacgctatg
ttagacaaacgcgatattcctggtggcgaaaacttaaaagttactttggaacgtgcttta
ccattctggcaagatcatattgctccagcattactagacgacaaaactgttttagtagct
gcacatggtaactcattacgcgctttagcaaaacatatcgaaggaatctctgacgaagac
attatggatcttgaaattccaacaggtcaaccacttgtttatgaattgaatgatgatcta
actgttgctaaaaaatactacttataa

DBGET integrated database retrieval system