KEGG   Enterococcus thailandicus: CK496_00875Help
Entry
CK496_00875       CDS       T05312                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eth  Enterococcus thailandicus
Pathway
eth00473  D-Alanine metabolism
eth00550  Peptidoglycan biosynthesis
eth01100  Metabolic pathways
eth01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eth00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CK496_00875
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CK496_00875
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CK496_00875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eth01011]
    CK496_00875
Enzymes [BR:eth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CK496_00875
Peptidoglycan biosynthesis and degradation proteins [BR:eth01011]
 Precursor biosynthesis
  Amino acid ligase
   CK496_00875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ASZ06551
UniProt: A0A179ER38
LinkDB All DBs
Position
164912..165988
Genome map
AA seq 358 aa AA seqDB search
MKITLLYGGRSAEHDVSILSAFSVLNAIYYAYYQVQLVFISKDGQWVKGPLLTEKPDNKE
LLHLTWDPSGKVTEGFTGKVINPGEIKEEGTIVFPVLHGPNGEDGTIQGFLETLNLPYVG
AGVLTSACAMDKIMTKYILQAAGVPQVPYVPVLKNQWKENPKKIFDQCEGSLLYPMFVKP
ANMGSSVGITKAENREELQNALETAYQFDSRAIVEQGIEAREIEVAVLGNEDVRTTLPGE
IVKDVAFYDYDAKYIDNKIEMKIPAEVPEEVHQKAQEYAKLAYTMLGGSGLSRCDFFLTS
KNELFLNELNSMPGFTEFSMYPLLWENMGLKYGDLIEELIQLGMNRYEQRQGFFEAHE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattactttactatatggtggacgtagtgcagaacacgacgtatctattctttcg
gcgttttctgttttaaatgccatttattacgcatattatcaagttcaactcgtttttatt
agcaaagatggacagtgggtcaagggcccattattaacagaaaaacctgataacaaagaa
ttattacatttgacatgggatccaagtggaaaagtaacagaaggattcactgggaaagtc
attaacccaggtgaaatcaaagaagaaggaacaatcgtttttccagtccttcatggtccg
aatggagaagatggaacgattcaaggatttttggaaacgttaaatctgccttatgttggt
gcaggcgtactgacaagtgcttgtgcaatggataaaattatgacgaagtacattttacag
gctgcgggtgttccacaagttccttatgtacccgtattaaaaaatcaatggaaagaaaat
ccgaaaaagatttttgatcaatgtgaaggttctctgttgtatccaatgtttgttaaacca
gcaaatatgggttcaagtgttggaattacaaaggctgaaaatcgtgaagagcttcaaaat
gcgttggaaacagcttatcaatttgattctcgtgcaatcgttgaacaaggaattgaagcg
cgtgaaattgaagtagctgttttaggtaatgaagatgtgcgaacaactttacctggagaa
atcgtgaaagatgttgctttttatgactatgatgcaaaatacattgataataaaatcgaa
atgaaaattcctgctgaagtacctgaagaagtacatcaaaaagcacaggaatatgcaaaa
ttggcttacacaatgcttggtggaagtggcttaagccgttgtgacttcttcttgacaagt
aaaaatgagttgttcttaaacgaattaaactcaatgccgggattcactgaattcagtatg
tatcctttattatgggaaaacatgggattaaaatatggtgacttaattgaagaactgatt
caattaggaatgaaccgctatgaacaaagacaaggcttttttgaagcacacgaataa

DBGET integrated database retrieval system