KEGG   Enterococcus thailandicus: CK496_11600Help
Entry
CK496_11600       CDS       T05312                                 

Definition
(GenBank) Hsp33 family molecular chaperone HslO
  KO
K04083  molecular chaperone Hsp33
Organism
eth  Enterococcus thailandicus
Brite
KEGG Orthology (KO) [BR:eth00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:eth03110]
    CK496_11600
Chaperones and folding catalysts [BR:eth03110]
 Heat shock proteins
  HSP33
   CK496_11600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 Fungal_lectin
Motif
Other DBs
NCBI-ProteinID: ASZ08493
UniProt: A0A249SLK8
LinkDB All DBs
Position
complement(2456480..2457367)
Genome map
AA seq 295 aa AA seqDB search
MEDYLVKALAHDGFVRAYAVQATNTVAEAQRRHDTWHTSSAALGRTLVGSLLLGATLKGE
DKLTVRIQGDGPAVGIVVDANGKGDVKGYIKNPYLSLPLNADGKIDVRGAVGTQGMFTVT
KDLGLKEPFSGQTPIVSGEIAEDFTYYLAISEQIPSAVGLSVLVNTDDSIKTAGGFMIQI
MPGADEETISKIEDQLKTTPRISTLLEEGHTPEEILKGLLGTEELNILEKMPVQFACDCS
KEKFAEAIIALGTEEIQAMIDEDHGAEAVCSFCNNKYEYSEQELLALKEEAVGGI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaagattatttagttaaagcactagcacatgatggttttgttcgtgcttatgcagta
caagcaacaaatacagtggcagaagcacaacgtcgccacgatacatggcatacatcgtcg
gcagcgttaggccgtacactagtcggtagtttattattaggagcgacactaaaaggtgaa
gataaattaacggttcgcattcaaggcgacggtccagctgttggaatcgttgttgatgca
aatggtaaaggcgatgtaaaaggatatattaaaaatccatatttgagtttgccgttgaat
gctgacgggaaaattgatgttcgtggtgcagtaggtacacaaggaatgttcactgtaact
aaggatttgggattaaaagaacctttttctggacagacacccatcgtttcgggggaaatt
gcggaagactttacttactacttagctatttctgagcaaattccatcagcagttggccta
agtgtcctagtaaatacagatgacagcatcaaaacagctggtggatttatgatccaaatt
atgccaggtgcagatgaagaaacaatttcaaaaattgaagaccaattgaaaacaacacca
agaatatcaacattgcttgaggaaggtcacacacctgaagaaattttgaagggattatta
ggaacagaagagttaaatatcttagaaaaaatgcctgttcaatttgcttgtgactgctca
aaagaaaaatttgcagaagctatcattgcactgggcacagaagaaattcaagcaatgatt
gatgaagaccatggtgcagaagcagtttgttcattttgtaataataagtacgagtattct
gaacaagaattattagcgctgaaagaagaagcagtaggaggaatttag

DBGET integrated database retrieval system