KEGG   Enterococcus thailandicus: CK496_11705Help
Entry
CK496_11705       CDS       T05312                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
eth  Enterococcus thailandicus
Brite
KEGG Orthology (KO) [BR:eth00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eth01001]
    CK496_11705
Enzymes [BR:eth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CK496_11705
Protein kinases [BR:eth01001]
 Serine/threonine kinases: Other
  Bacterial family
   CK496_11705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Kdo Haspin_kinase RIO1 DUF4366 Seadorna_VP7 FTA2
Motif
Other DBs
NCBI-ProteinID: ASZ08514
UniProt: A0A249SLE1
LinkDB All DBs
Position
complement(2480905..2482941)
Genome map
AA seq 678 aa AA seqDB search
MIELGKKLNGRYQITGNIGSGGMANVFLAHDLILDRDVAVKVLRFDFQNDKTAIRRFQRE
ALAATELVHPNIVSVYDVGEEAGMQYLVMEYVKGMDLKRYIQTHYPIPYQTAVDIMQQIL
SAISLAHNHQIIHRDLKPQNILIDHEGVVKITDFGIAIALSETSITQTNTMLGSVHYLSP
EQARGSMATKQSDIYALGIILYEMLTGSVPFDGESAVTIALKHFQDELPSIKAIDPGAPQ
ALENVVLKATAKEPTDRYLTADEMNEDLATVLSPARANEPKWEPQAMLNETKVLTPIDAD
SPMPDSFKSMRLPDEHDVWEQPNHQPEEEEEKPKKKRKKWWILLILVLLGLGIGAGVFFA
SGGRGEVEVPDVSDLTEAAARTVLENANLKVASETEEIADDKIEEGNVVKTDPAAKTTVK
RNREVKLYLSSGSKKIKLKDYAGVNYDEAKANLIELGFSENQIKSEEEYSSEVEKGAIIS
QTPADGEVDPDSDTITFKVSKGAEPVYLYNHTGENYDEVYSTLISAGFLASNISVSYDYS
DTIAAGNIISQNPGSGEFTAAETAVSFVVSQGAEEKPSRLNDISGYSKSEAQNYLSGIGA
EYIGHETSEYSDTVDKDKVIRTNPGVGASIAKGDIVSVVYSKGPDPAKASSEKDSSSSST
KETTETTGESKEENKSQE
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagttaggtaagaaattaaatggacgttaccaaatcactggcaatattggcagt
ggcggaatggcaaatgttttcttggcccatgacctaatcttagaccgtgatgtagctgtc
aaggttttacggtttgactttcaaaacgacaaaactgctatccgcagatttcaaagagaa
gcgttagcagcaactgaattggttcatccaaacatcgtgagtgtgtatgatgttggtgaa
gaagctggtatgcaatatttagtaatggaatatgtgaagggaatggatctcaagcgatac
atccaaacccattatccaattccatatcagacagctgttgatattatgcaacaaatttta
tcagcgatttctttggctcataatcatcaaatcatccatcgcgatttaaaacctcaaaat
attttgattgaccatgaaggtgtcgtgaagattactgattttggaattgcgattgcatta
tctgaaacatcaattactcaaacgaatacaatgttaggctccgtgcattacttgtcacct
gaacaagcaagaggaagtatggctacgaaacagtccgatatttatgcgcttggaatcatt
ctttatgagatgttgacaggtagtgtgccatttgacggtgagtcagcagtaacgatcgct
ttgaaacattttcaagatgagctaccttcgattaaagcaattgatccgggagcgccacag
gcattggaaaatgttgtattgaaagcaactgcaaaagaaccaacggatcggtatttgact
gcggatgaaatgaatgaagacttagcaacggttctttcacctgcgcgtgcgaatgaacca
aagtgggaaccgcaagctatgctgaatgaaaccaaagtgctgacaccgattgatgcagac
tcaccaatgccagattcgttcaagtcgatgcgtttaccagatgagcatgacgtgtgggaa
caaccaaatcatcaaccagaagaagaggaagaaaaaccaaagaaaaaacgaaaaaaatgg
tggattttactcattctggtcttactgggcttaggcatcggcgcaggcgtattttttgct
tctggtggtcgaggcgaagtggaagtaccagatgtatcagatttaacggaagcagcggct
cgaacggtgttggaaaacgcgaatctaaaagtagcgagcgagacagaagaaattgctgat
gacaaaattgaagaaggaaatgtggttaaaacagatcctgcagcaaagacaactgtgaaa
aggaatcgcgaagtaaaattatatttaagcagtggctcgaaaaaaatcaaattaaaagat
tatgctggcgtaaactacgatgaagcaaaagcaaatttaattgaattaggtttttcagaa
aaccaaattaagtcggaagaagaatatagttctgaagttgagaagggtgcaattatttct
caaacacctgcggacggagaagttgatccggattctgatacaattactttcaaagtgagc
aaaggagcggaaccagtttatttgtataatcatacaggcgaaaactatgatgaagtttat
agtacgttgatatctgcaggctttttagcatcgaatattagcgtgagctatgattatagc
gatacgatagctgcgggaaatattattagtcaaaatcccgggtcaggcgaattcacggca
gcagaaacagctgttagttttgtagtcagccaaggagctgaggaaaaaccaagtcgtcta
aatgatatttcaggctattcaaagagtgaagcacaaaattatttatctgggattggcgct
gaatacattggacatgaaacatctgaatactcagatactgtcgacaaggataaagttatt
cgtactaatccaggtgtcggagcaagtattgctaaaggtgatatcgtgagtgttgtttac
tccaagggaccagatccagcaaaagcttcttcagaaaaagattcatcaagtagttcaaca
aaagaaacgacagagacaacaggagaatcaaaggaagaaaataaatcacaagagtaa

DBGET integrated database retrieval system