KEGG   Candidatus Endomicrobium trichonymphae: RSTT_254Help
Entry
RSTT_254          CDS       T05087                                 

Gene name
porA
Definition
(GenBank) pyruvate:ferredoxin oxidoreductase (PFOR) subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
eti  Candidatus Endomicrobium trichonymphae
Pathway
eti00010  Glycolysis / Gluconeogenesis
eti00020  Citrate cycle (TCA cycle)
eti00620  Pyruvate metabolism
eti00633  Nitrotoluene degradation
eti00640  Propanoate metabolism
eti00650  Butanoate metabolism
eti00680  Methane metabolism
eti01100  Metabolic pathways
eti01110  Biosynthesis of secondary metabolites
eti01120  Microbial metabolism in diverse environments
eti01130  Biosynthesis of antibiotics
eti01200  Carbon metabolism
Module
eti_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSTT_254 (porA)
   00020 Citrate cycle (TCA cycle)
    RSTT_254 (porA)
   00620 Pyruvate metabolism
    RSTT_254 (porA)
   00640 Propanoate metabolism
    RSTT_254 (porA)
   00650 Butanoate metabolism
    RSTT_254 (porA)
  09102 Energy metabolism
   00680 Methane metabolism
    RSTT_254 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    RSTT_254 (porA)
Enzymes [BR:eti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     RSTT_254 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: BAV58834
UniProt: A0A1C9ZRW6
LinkDB All DBs
Position
414072..415277
Genome map
AA seq 401 aa AA seqDB search
MIKTVYSKGKLVAKTGNEVVAEAMRQIEPDVVAAYPITPATEIVQIFSQFVADGIVKSEY
VAVESEHSAMSATIGASAAGARAMTGTSSQGLSLMWEMLYIASGLRLPIVMAEVNRAISA
PINIHGDQSDTMGARDAGWIQIYSENSQEAYDNMIQATRIAEKAKLPTLVTTDGFIISHC
MEVVETYPDADVKAFIGKYEPERYLLDIKKPYTLGSIDLQDYYFEHRYQLAQAMRNAKNI
VLDVAKDFEKTFGRKYDLCEKYMLDDAEIAIAVIGSTAGTAKVVVNELREKGIKAGLLKI
RVYRPFPAEEIAKDLAHVKAVAVMDRADSCSGAFAPVYSDIVASLYASGVTNPKVVNYVY
GLGGREINTGHIIGIYEMLCKIASGTEKSSNKVEYINVRIK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgataaagacagtatactcaaaaggtaaacttgttgcaaagaccggcaacgaagttgta
gctgaagcaatgcgccagatagagccggatgtagtagcggcatatcctataactccggca
actgaaatcgtacagattttctcacagtttgttgcagacggtattgtaaaaagcgagtat
gtcgcggtagaaagcgagcattcggcgatgtcggctacgataggggcatcggcagccggc
gcaagagcaatgacaggcacttcttcacagggattatctcttatgtgggaaatgctttat
atagcttcaggacttaggcttcctatagttatggcggaagtcaacagggcaatttctgct
ccgattaacattcacggagatcagtcggatacaatgggcgcaagagatgcgggatggatt
cagatatattcggaaaactcgcaggaagcttacgataatatgattcaggctacaagaata
gccgaaaaagcaaaacttcctacgcttgtgacgacagatgggtttattatttctcattgt
atggaagttgtcgagacttatcctgatgcagatgtaaaagcttttataggtaaatacgaa
cctgaaagatatcttttagatattaagaagccttatacgctaggttcaattgatttacaa
gattactattttgaacacagataccagcttgcgcaggctatgagaaatgcgaaaaatata
gttttagatgttgcgaaagattttgaaaaaacttttggacgcaaatacgatttatgtgag
aaatatatgcttgacgatgcagaaattgcaatagcggttataggttcaacagccggaact
gcaaaagtcgtagtaaatgaattgagagaaaagggtattaaggcgggtcttttaaagata
agagtttacagaccgttcccagcggaagaaattgcaaaagatttagcgcatgttaaagca
gttgcggttatggacagagcggattcatgttccggtgcatttgctcctgtttattcggat
attgtcgcatctttgtatgcctcgggagttacaaaccctaaagttgtgaattatgtttac
ggtcttggcggaagagaaatcaataccggacatattatcggtatttacgagatgctttgt
aaaattgcttcaggtacagaaaaatcgtcaaataaagttgaatatataaatgtaagaata
aaataa

DBGET integrated database retrieval system