KEGG   Empidonax traillii (willow flycatcher): 114055112
Entry
114055112         CDS       T05887                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04012  ErbB signaling pathway
etl04110  Cell cycle
etl04150  mTOR signaling pathway
etl04310  Wnt signaling pathway
etl04340  Hedgehog signaling pathway
etl04510  Focal adhesion
etl04910  Insulin signaling pathway
etl04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114055112 (GSK3B)
   04310 Wnt signaling pathway
    114055112 (GSK3B)
   04340 Hedgehog signaling pathway
    114055112 (GSK3B)
   04150 mTOR signaling pathway
    114055112 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114055112 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114055112 (GSK3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114055112 (GSK3B)
   04916 Melanogenesis
    114055112 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114055112 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etl03036]
    114055112 (GSK3B)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     114055112 (GSK3B)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   114055112 (GSK3B)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114055112 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 114055112
NCBI-ProteinID: XP_027734702
LinkDB
Position
Unknown
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDKPALF
NFTTQELSSNPSLASILIPAHARNQAAASTPTNATAASDVNAGERVQTNSVATASASNST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtccgggcggcccaggaccacctccttcgcggagagctgcaagccggtgcagcagccc
tcggccttcggcagcatgaaagtcagccgagacaaagatggcagcaaggtgactacagta
gtggcaactcctggacaaggtccggaccgaccacaagaagttagctacacagacaccaag
gtgattggaaatggatcttttggtgttgtgtatcaagccaaactctgtgattcaggagag
cttgtggccattaagaaagtcctgcaggataaaagatttaagaacagagagctccaaatt
atgagaaagttggatcattgtaacattgtccgattgcgctatttcttctactctagtgga
gagaagaaagatgaggtgtatctcaacttggtgctggactatgttcctgaaacagtatac
agagttgccagacattatagtcgggccaaacagacactccctatgatttatgtcaagttg
tacatgtatcagctgttccggagtttagcctatatccattcctttgggatctgccaccgg
gatataaaaccacagaacctcttgctggaccctgatacagctgttctaaaactctgcgac
tttggaagtgcaaagcagctggttcgtggagaaccaaatgtctcgtacatctgctctcgg
tactacagggcaccagagttgatctttggagccaccgattatacctccagtatagatgtg
tggtcagcaggctgtgtattggctgaactgttactaggacaaccgatctttccaggtgac
agtggtgtggatcagttggtggaaataatcaaggttctgggaacgcctacaagggagcaa
attagagaaatgaatccaaactatactgaattcaaatttcctcagattaaggcacatcca
tggactaaggtcttccggccccgcactccaccagaagcgatcgcgctatgtagccgtctg
ttggagtacacccccactgcccgcctgactcccctggaggcctgtgcacactctttcttc
gatgaactacgggacccaaatgtcaagttaccaaatgggcgagataaacctgcactcttc
aatttcaccactcaagaactgtcaagtaacccatctctggcttcgatcctcatccctgct
catgcccggaaccaagcagctgcttcaacccctacaaatgctacagcggcctcagatgtt
aacgcaggagaacgagttcagaccaatagtgtagctacagcatcagcctccaactccacc
tga

DBGET integrated database retrieval system