KEGG   Empidonax traillii (willow flycatcher): 114055175
Entry
114055175         CDS       T05887                                 

Gene name
IHH
Definition
(RefSeq) indian hedgehog protein
  KO
K11989  indian hedgehog
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114055175 (IHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:etl01002]
    114055175 (IHH)
Peptidases and inhibitors [BR:etl01002]
 Cysteine peptidases
  Family C46: hedgehog family
   114055175 (IHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 114055175
NCBI-ProteinID: XP_027734834
LinkDB
Position
Unknown
AA seq 408 aa
MKPARLLLLLSGCALLLAPAVRGCGPGRVVGSRRRPPRKLIPLAYKQFSPNVPEKTLGAS
GRYEGKIARNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPG
VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGMLARLAVEAGFDWVYYESKA
HIHCSVKSEHSAAAKTGGCFPGRALATLEDGAQTPLWALRPGQRVLAMDGSGRPTYSDFL
AFLDKEPRALTTFHVIETQEPPRRLVLTPTHLLFVAENASAPTTHFRPIFASLVRPGHFV
LVAAGGSSLQPAKVVGVRDRRDMGAYAPLTRHGTLVVDGVVASCFALVQEQQLAQLAFWP
LRLYHSLVGWPGAQGDGVHWYSGLLYRLGRLLLPPDSFHPLGVPRAES
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaagccggcgcggctgctgctgctgctgagcgggtgcgcgctgctgctggcgccggcc
gtgcgcggctgcgggccgggcagggtggtgggcagccgccgccgcccgccccgcaagctc
atcccgctcgcctacaaacagttcagccccaacgtccccgagaagacgttgggggccagc
ggccgctacgagggcaagatcgcgcgtaactcggagcgcttcaaggagctcacgcccaac
tacaaccccgacatcatcttcaaggacgaagagaataccggcgccgaccggcttatgacc
cagcgctgcaaggaccgcttgaactccctggccatctctgtcatgaatcagtggccaggg
gtgaagctgagggtgacggagggctgggatgaggatgggcaccactcagaggagtcgctg
cattacgagggccgagctgtggacatcacaacctcggacagggaccgcaacaagtacggc
atgctggctcgcctggctgtggaggctggctttgactgggtctactacgagtccaaagca
cacatccactgctctgtcaagtcagagcactcggccgctgcgaagacagggggctgcttt
cctgggcgggcactggcaacgctggaggacggtgcccagactccactgtgggcactgcgc
ccgggccagcgagtgctggcaatggacgggtcgggcaggcccacctacagtgacttcttg
gctttcctggacaaggagccccgtgccctcaccaccttccatgtcatcgagacacaggag
ccaccccggcgcctggtcctgacacccacccacctgctctttgtggcggagaacgcttca
gcaccgaccactcacttccgccccatctttgccagccttgtgcgccctggacatttcgtg
cttgtggcagcagggggaagcagcttgcagcctgccaaagtggtgggggtgcgggaccgg
agggacatgggagcctatgcccctctgacacgccacgggacgctggtggtggatggtgtg
gtggcctcctgcttcgccctggtgcaggagcaacagctggcgcagctggccttctggcca
ctccggctctaccacagcctggtggggtggccaggggcacagggagatggtgtgcactgg
tactcagggctgctctaccgcctgggcaggctgctcctgccccccgacagcttccaccca
ctgggggtaccccgggcagagagctga

KEGG   Empidonax traillii (willow flycatcher): 114055534
Entry
114055534         CDS       T05887                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114055534 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:etl01002]
    114055534 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:etl00536]
    114055534 (SHH)
Peptidases and inhibitors [BR:etl01002]
 Cysteine peptidases
  Family C46: hedgehog family
   114055534 (SHH)
Glycosaminoglycan binding proteins [BR:etl00536]
 Heparan sulfate / Heparin
  Morphogens
   114055534 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 114055534
NCBI-ProteinID: XP_027735589
LinkDB
Position
Unknown
AA seq 425 aa
MDEMLLLTRILLVGFICALLVSSGLTCGPGRGIGKRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLVADTEGRLLYSD
FLTFLDREDGSHKLFYVIETRQPRARLLLTAAHLVFVAPQHNQSQEGTPSSRALFASRVR
PGQRVFVLGEGGRQLLPAAVHSVSLREEASGAYAPLTAQGTILINRVLASCYAVVEEHSW
AHWAFAPFRLLQGMLAALCPSGGASPMGDPTAPGIHWYSRLLYRIGSWVLDSDSLHPLGM
VVSSS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggacgaaatgctgctgttgacaagaattctcttggtgggcttcatctgcgctctttta
gtctcctctgggctgacttgtggaccaggcaggggcattggaaaaaggagacaccccaaa
aagctgacccctttagcctataagcagtttattcccaatgtggcagagaagaccctaggg
gccagtggaagatatgaagggaagatcacaagaaactccgagagatttaaagaactaacc
ccaaattacaaccctgacattatttttaaggatgaagagaacacgggagctgacagactg
atgactcagcgctgcaaggataagctgaacgccctggcgatctcggtgatgaaccagtgg
cccggggtaaagctgagggttaccgagggctgggacgaggacggccaccactccgaggag
tccttgcattacgagggccgcgccgtggacatcaccacttcggatcgggaccgcagcaag
tacggcatgctggcccggctggccgtcgaggccggcttcgactgggtctactacgagtcc
aaggcacatatccactgctctgtcaaagcagaaaactcggtggccgccaaatctgggggc
tgcttccctggctcagccacggtgcacctggagcaaggcggtaccaagctggtgaaggac
ctgagacccggagacagggtgctggtggctgacaccgaaggccgcctgctctacagcgac
ttcctcaccttcctcgaccgggaggacggctcccacaagctcttttacgtcattgagacg
cggcagccccgggcccggctgctgctgacggccgcccacctggtcttcgtggccccccag
cacaaccagtcgcaagaggggacccccagcagccgggcgctcttcgccagccgcgtgcgg
ccgggccagcgggtcttcgtgctgggcgagggcgggcggcagctcctgcccgcggccgtg
cacagcgtgtcgctgcgggaggaggcatcgggggcctacgccccgctcaccgcccagggc
accatcctcatcaaccgcgtgctggcctcctgctacgccgtcgtggaggagcacagctgg
gcacactgggccttcgcccccttccgcctgctccaggggatgctggccgccctctgcccc
tccggaggggcgtcccccatgggtgaccccacggcccccggcatccactggtactctcgg
ctgctctaccgcatcggcagctgggtgctggatagtgactctctgcacccgctgggcatg
gtggtgtcgtccagctga

KEGG   Empidonax traillii (willow flycatcher): 114071902
Entry
114071902         CDS       T05887                                 

Gene name
DHH
Definition
(RefSeq) desert hedgehog protein
  KO
K11990  desert hedgehog
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114071902 (DHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:etl01002]
    114071902 (DHH)
Peptidases and inhibitors [BR:etl01002]
 Cysteine peptidases
  Family C46: hedgehog family
   114071902 (DHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 114071902
NCBI-ProteinID: XP_027765583
LinkDB
Position
Unknown
AA seq 414 aa
MPRWRPLALVLLGLAACLLAAPVLGCGPGRGPVGRRRLGRRQLSPLLYKQFVPNVPEQTL
GASGKAEGKVLRGSERFRDLVPNYNPDIIFKDEENTGADRLMTERCKERVNSLAIAVMNM
WPGVKLRVTEGWDEDGHHLPDSLHYEGRALDITTSDRDRHKYGMLARLAVEAGFDWVYYE
SKAHIHVSVKADNSLAIRTGGCFPGHATVTLQSGERRGLAELRRGDWVLGAEPGGRLVPT
EVLLFLDRDPGRRASFVAIETAGPARRLLLTPSHLVFAARGAANGSAAAFLPVFARRVRP
GDAVLARGAGGQGLRPARVLRVSREDGVGVFAPLTSHGTLLVNGVLASCYAVLESHRWAH
RAFAPLRLFHGLLALLPARAPPANGTVPEAGMHWYSRLLYRLAGGVLGHEALQL
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgccccggtggaggccgctcgccctcgtcctgctcggcctcgccgcctgcctgctggcc
gcgccggtgctgggctgtggtccgggccggggcccggtggggcggcggcggttggggcgg
cggcagctctcaccgctgctctacaagcagttcgtgcccaacgtgcccgagcagacgctg
ggggcgagcgggaaggcggagggcaaagtgctgcggggctcggagcgcttcagggacttg
gtgcccaactacaaccccgacatcatcttcaaggacgaggagaacacgggggcggatcgg
ctcatgaccgagcgctgcaaggagcgggtgaactctctggccatcgcggtgatgaacatg
tggccgggggtgaagctgcgggtgacggagggctgggacgaggacgggcaccacctcccc
gactcgctgcactacgagggccgggcgctggacatcaccacgtccgaccgggaccgccac
aagtacggcatgctggcccgcctggccgtggaggccggcttcgactgggtctactacgag
tccaaggcacacatccacgtctctgtcaaagcagacaactcgctggccatccgcaccggc
ggctgcttccccggccacgccaccgtgacgctgcagagcggcgagcgccggggcctggcc
gagctgcgccggggcgactgggtgctgggcgccgagccgggtgggcgcctggtgcccacc
gaggtgctgctcttcctcgaccgggacccgggccggcgcgcctccttcgtggccatcgag
acggccggcccggcgcgccggctgctcctcaccccgtcccacctggtgttcgccgcccgc
ggggccgccaacggctccgccgccgccttcctgcccgtcttcgcccgccgcgtgcgcccc
ggcgacgccgtgctggcccgtggggccggcgggcaggggctgcggcccgcgcgggtgctg
agggtctcgcgggaggacggcgtgggcgtcttcgccccgctcacctcccacgggaccctg
ctggtcaacggggtgctggcgtcctgctacgccgtcctggagagccaccgctgggcccac
cgcgccttcgccccgctgcgcctcttccacgggctgctggcgctgctgcccgcccgcgcc
ccgccggccaacgggacggtgcccgaggcgggcatgcactggtactcccgcctgctctac
cggctggcggggggcgtgctgggccacgaggccctgcagctctag

DBGET integrated database retrieval system