KEGG   Empidonax traillii (willow flycatcher): 114055235
Entry
114055235         CDS       T05887                                 

Gene name
PTCH1
Definition
(RefSeq) protein patched homolog 1 isoform X1
  KO
K06225  patched 1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114055235 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 114055235
NCBI-ProteinID: XP_027734954
LinkDB
Position
Unknown
AA seq 1437 aa
MASAANASEPETSSSAGGGGHPGRAARSGGGRRRRTGGNRRAAAPDREYLQRPSYCDAAF
ALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLRAAN
LETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPQEDGANVLTTEALRQHLD
SALQASRVHVYMYNRQWKLEHLCYKSGELITEAGYMDQIIEYLYPCLIITPLDCFWEGAK
LQSGTAYLLGKPPLQWINFDPLEFLEELKKINYQVESWEEMLNKAEVGHGYMDRPCLNPA
DPDCPITAPNKNSTKPLDVALVLSGGCYGLSRKYMHWQEELIIGGTVKNSSGKLVSAQAL
QTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRMYVEVVHQSVAQNSTQKVL
SFTTTTLDDILKSFSDVSAIRVASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVALS
VAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGEC
LKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDL
YRREDRRLDIFCCFTSPCVTRVIQIEPQAYAENDNACYSPPPPYSSHSFAHETQITMQST
VQLRTEYDPHTQVYYTTAEPRSEISVQPVTVTQENLSCQSPDSTSSTRDLLSQFSDSGVH
CLEPPCTKWTLSSFAEKHYAPFLLKPKAKIVVIFLFLGLLGLSLYGTTRVRDGLDLTDIV
PRETREYDFIAAQFKYFSFYNMYIVTQKADYPNVQHLLYELHRSFSNVTYVLLEEDRQLP
KMWLHYFRDWLQGLQDAFDSDWETGKITYNNYKNGSDDAVLAYKLLVQTGNRAKPIDISQ
LTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHCPEWVHDKADYMPETRL
RIPAAEPIEYAQFPFYLNGLRETSDFVEAIEKVRAICSNYTSLGIASYPNGYPFLFWEQY
IGLRHWLLLSISVVLACTFLVCALFLLNPWTAGIIVVVLALMTVELFGMMGLIGIKLSAV
PVVILIASVGIGVEFTVHVALAFLTAIGDRNHRAVLALEHMFAPVLDGAVSTLLGVLMLA
GSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGHNRLPTPSPEPP
PSVVRFALPPGHTNHASDSSDSEYSSQTTVSGISEELHQYEAARSPGAPVHQVIVEATEN
PLFARSTVVQPEARQQPCPGVPSESSTQRAWRQGRQPRREAREGQQPPPYRPRRDAFEIS
SEGHPAPGSRDRSGHRARSHTLRSPLIGAAGPAYCQPITTVTASASVTVAVHPALHGHGA
RPGGFPPCEGHQETDHAPFEDPHVPFNVWCERRNSKVEVIELQDVECEERVPGNSSQ
NT seq 4314 nt   +upstreamnt  +downstreamnt
atggcctcggccgctaacgcgtcggagccggagaccagcagcagcgcgggcggcggaggc
caccccggccgggcggcgaggagcggcggcgggaggcggcgaaggaccggaggcaatcgg
cgcgccgcggcgcccgaccgggagtatctgcagcggccaagctactgcgatgcggcgttc
gccttggagcagatttcaaaggggaaggcgacgggacggaaagcgccgctgtggctgcga
gcaaagtttcagagactgttgtttaaactgggctgttacattcagaaaaactgcgggaag
tttttggtggtcggcctcctgatatttggggctttcgctgtaggattaagggcggctaac
ctggagaccaacgtggaggagctgtgggtggaagttggtggacgagtgagtcgggagtta
aattacacacggcagaagattggagaagaggccatgttcaacccccagctcatgatccag
actccacaggaagatggtgctaatgtactgacgacagaagcactgcgacagcaccttgac
tctgccctccaggccagcagggtacatgtctatatgtacaacagacagtggaaattggaa
catttgtgttacaaatcaggagaactcatcacagaagcaggttacatggaccagatcata
gaatatctttatccttgtttaattatcactcctctggactgcttctgggaaggagcaaag
ctacaatcaggaactgcatatctgttagggaagcctcctttgcagtggatcaactttgac
cccttagaattcttggaagagttaaagaaaataaactaccaagtggagagctgggaagaa
atgctgaataaagcagaggttggtcatggttatatggatcgaccctgcctgaatcctgct
gatcccgattgcccaatcacagctcccaataaaaattccaccaaacctcttgatgtagcc
cttgttttgagtggtggatgctatggactgtcaagaaaatacatgcattggcaagaggag
ctgattataggtggtacagtcaagaacagttctggtaaacttgtcagtgcccaggctctg
caaaccatgtttcagttaatgactcctaagcaaatgtatgagcacttcaaggggtatgaa
tatgtttcccatatcaactggaacgaggataaggcagcagcaattctggaagcctggcag
aggatgtatgttgaggttgttcatcaaagtgttgcacaaaactctacccagaaggtgctc
tccttcactacaaccaccctggatgacatcctgaagtcattttctgatgtcagcgctatc
agagtagccagtggctacttactaatgcttgcctacgcctgtttaacgatgctgcggtgg
gactgtgccaagtctcagggtgctgtggggctggcaggagtcctgctggttgcactctcg
gtggctgcaggattgggcctgtgctcactgattggaatttcctttaatgctgccacgact
caggttttgccttttcttgctcttggagttggtgtagatgatgttttccttctggcacat
gcgtttagtgaaacagggcagaataagagaattccatttgaggacaggacaggtgaatgt
ctgaagcgcacgggagcgagtgtagcccttacatcaatcagtaacgtcactgctttcttc
atggctgccctgatccctattcctgccctacgagcattctcactccaggcagcagttgtg
gtggtgttcaactttgctatggttctgctgattttccctgccatcctgagcatggatctt
tatcgtcgtgaggacaggaggctggatatattctgctgtttcacaagcccgtgtgtcacc
agggtgattcagatcgagccccaggcgtacgcggagaacgacaacgcgtgctacagcccc
cctcccccgtacagcagccacagctttgcccacgagacccagatcacgatgcagtccacg
gtgcagctgcgcacggagtacgatccccacacgcaggtgtactacaccacggcagagccc
cgctcggagatctccgtgcagcccgtcaccgtcacgcaggagaacctgagctgccagagc
ccggacagcaccagctcgacgagggatttgctctcccaattctcagactccggcgtgcat
tgccttgagcccccctgtaccaagtggacgctctcgtcctttgcagaaaagcattatgct
ccattcctcctgaaaccaaaagctaagattgtggttatttttctttttctgggtttactt
gggctcagcctttacggaactacccgggtgagagatggactagatctcacagacattgtg
ccacgggaaacacgggaatatgactttattgctgcacagttcaagtacttttcgttctac
aacatgtatattgtgacacagaaggcggactatccaaatgtccagcacttactttacgag
cttcacagaagtttcagcaacgtgacgtatgttttgttggaagaggacaggcagcttccc
aaaatgtggttgcactactttcgagactggctgcaaggacttcaggatgcatttgacagc
gactgggaaactgggaagatcacctacaacaactataaaaacggatctgatgacgctgtt
ttggcttacaaactcttggtgcaaacaggcaaccgtgcaaaacccattgacatcagccag
ttgaccaagcagcgtctggtggacgcggacggaatcattaacccgagcgccttctacatc
tacctgacagcctgggtcagcaacgaccccgtggcctacgctgcctcgcaggccaacatc
cgcccgcactgccccgagtgggtgcacgacaaggcagactacatgccagagacacggctg
aggattccagcagctgagcccatagagtacgctcagtttcctttctacctcaatggactg
cgtgaaacttctgactttgtggaggcgattgagaaagtgagagcgatctgcagtaactac
accagcctggggatcgccagctacccgaatggttacccctttctcttctgggagcagtac
attggccttcgtcactggctcctcttatccattagcgtggttttggcttgcacgtttctg
gtgtgtgccctcttcctcctaaacccctggacagctgggatcattgtggtggtgctggct
ctgatgactgtggagctgtttggcatgatgggtctaattggaataaagctgagtgcggtg
cctgtggttatcctgattgcttctgttggcatcggcgtggaattcaccgtccacgttgct
ttggcatttttgactgccataggagacaggaaccacagggctgtcctagccttggaacac
atgtttgcaccggtgctggacggggctgtgtccactctgctcggggtgttaatgcttgca
ggatcagagtttgatttcattgtcaggtatttctttgctgttttggcaatcttaaccatt
ctgggagttctcaatggattggtgctgcttcctgttcttctttcattctttggaccatac
cctgaggtttctccagccaatggacacaacagattgcccaccccgtctcctgagccaccc
cccagcgtcgtgaggtttgccctgccccctgggcacacaaaccacgcctcggactcctct
gattccgagtacagctctcaaaccacagtatctggcatcagcgaggagctgcaccagtac
gaggccgcccgcagccccggggcacccgtccatcaggtcatcgtggaggccactgagaac
cctctctttgcaaggtccactgtggtgcagcccgaagccaggcagcagccgtgtcccggg
gtgccatcagagagcagcacgcagcgggcgtggcgccagggcaggcagcccaggcgggag
gcgagggaagggcagcagccccccccttaccgcccgcgcagggacgccttcgaaatttcc
tcggaggggcacccagcacccggcagcagggaccgctcgggacacagggcccgctcccac
accctgaggagcccgttgatcggggctgcagggccagcctactgccagcccatcaccact
gtgaccgcctcggcttccgtgactgtcgccgtccaccctgccctgcacggccacggcgcc
cgcccgggcggcttcccgccctgcgagggccaccaggaaaccgaccacgcgccctttgag
gacccccacgtgcctttcaacgtgtggtgcgagaggaggaactctaaagtagaagttata
gagctgcaagatgttgaatgtgaggagagggtacctggcaacagctcgcagtaa

KEGG   Empidonax traillii (willow flycatcher): 114061960
Entry
114061960         CDS       T05887                                 

Gene name
PTCH2
Definition
(RefSeq) LOW QUALITY PROTEIN: protein patched homolog 2
  KO
K11101  patched 2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114061960 (PTCH2)
SSDB
Motif
Pfam: Patched Sterol-sensing MMPL
Other DBs
NCBI-GeneID: 114061960
NCBI-ProteinID: XP_027748715
LinkDB
Position
Unknown
AA seq 1474 aa
MGAAAAAAANGSGGGGAAPAPPAPXLPFRGAAGGRRRTHSPPSAPAPAPAPAPARPRYAH
GGRRRARPHITGVPSPASRPAMPAEPPRAAPPPPLRAARRKPLPEVTRPPRASRPAAGPL
ARAGAPRLLCRADPISPLPQGRAVGQRTPLWLRARFQALLFALGCRIQRHCGKVLFVGLL
VFGALAVGLRVASIETDIEHLWVEAGSRVSQELRYTKEKLGEESVYTSQMLIQTPKRDGD
NILTQEALQLHLEAALAASKVQVSLYGKSWDLNKICYKSGVPIIENGMIERMIEKLFPCV
ILTPLDCFWEGSKLQGGSAYLPGRPDIQWSNLDPLQLMEELGQFTSLEGFKELLDKAEVG
QAYMERPCLDPRDPQCPPSAPNKQSQQNPDIPAELSGGCHGFSRKFMRWQQELILGGTTK
DSQGKLLRAEALQTMFLLMSPRQLYEHFKDDYEIHDISWSEEKAGAILEAWQRKFVELAQ
DSIPPNATQSVHAFSTTTLNDIMKSFSDVSAIRVAGGYLLMLAYACVTMLRWDCSKSQGA
VGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFTETSQH
VPFKERTGECLKRTGTSVALTSVSNMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMVLF
VFPAILSLDLHRREKRRLDILCCFYSPCSSRVIQIQPQELADANDNHACHPSPYGHPSVA
TSTQITTTVQAFTRCDPSGHHIVTVLPPTSQVCTSPAVLLPPSDPLGSQVFAPSSSTRDL
LAQLDEAKGRRECVPLPFCRWSLADFAREKYAPLLLRTRTKAVVVVLFLALLGLSLYGTT
MVHDGLYLTDIVPRDTKAHAFISAQFKYFSFYNMFIVTKGGFHYPGAQAALLSLHQAFST
VKYVVREGNRDLPKMWLHYFQDWLRGLQATFDRDWQAGRITHDSYRNGSEDGALAYKLLI
QTGNKKEPFNFNQLTTRRLVDENGIIPPDTFYICLTVWASNDPLGFAASQANFYPPPPEW
IHDKYDTTGENLRIPAAQPLEFAQFPFYLSGLRRTSDFVEAIESVRAICREAAQRHGVLS
YPSGYPFLFWEQYIGLRHWFLLAISILLACTFLVCALLLLNPWTAGIIVSILAMMAVELF
GIMGLMGIKLSAIPVVILIASVGIGVEFTVHVALGFLTAVGSRNVRSAAALEHTFAPVMD
GAVSTLLGVLMLAGSEFDFIMRYFFAVLTILTLLGLLNGLVLLPVLLSVVGPPPEASLVD
NGSCLTPPESVPPCLGPGGLYVRRSPAWPATFPEPSDTEHYTEGVGPSNPRGPFIVPPTP
AHILLEAGKDPSFPRITVLKPYKDSLEVQGKKEASGSQPTPTLPFGEPCPTLAREHLQPC
PPGTRPAPTAALPTYSTHLQGPAGSYTTVTATASVTVALHPTLPGSYPSFSPEGFASSER
DCLDEPSVPSTSGTAVPDAFEMQSMGHHGAGAQR
NT seq 4425 nt   +upstreamnt  +downstreamnt
atgggcgctgccgcggcggcggcggccaatgggagcggcggcggcggcgcggccccggcg
ccccccgcccccngcctcccctttagaggcgcggcgggcggccggcggcgcacacacagc
cctccatccgcaccggcaccggcaccggcaccggcaccggcacggccccgctacgcgcat
gggggccgccgccgcgctcggccccacataacgggggtgcccagccccgccagccgcccc
gccatgccggccgagcccccccgcgccgcgccgcctccgccgctccgcgccgcccgccgc
aagccgctgcccgaggtgacgcggccgccgcgggcatcccgccccgccgcgggtcccctt
gcccgggcaggggctccccgtctcctctgccgggctgaccccatctcgccccttccgcag
ggcagggccgtgggccagaggactccgctgtggctgcgggcccgctttcaggcgctgctc
ttcgccctgggctgccggatccagcggcactgcgggaaggtgctcttcgtggggctgctg
gtgttcggggcgctggccgtgggactacgggtggcctccatcgagaccgacatcgagcac
ctctgggtggaagcgggcagccgggtgagccaggagctgcgctacaccaaggagaagctg
ggcgaggagtctgtctacacctcccagatgttgatccagaccccgaagagggatggggac
aatatcctgacgcaggaggccctgcagctccacctcgaggcggccctggcagccagcaag
gtccaggtctcgctgtacggaaaatcgtgggatttgaacaagatttgctacaagtcaggt
gtccccatcattgagaatggcatgatagagaggatgatagagaagctgttcccttgcgtg
atcctgacaccactggactgcttctgggaaggttccaagctgcagggaggctcagcctat
ctcccgggccgccccgacatccagtggagcaacctcgaccctctgcagttgatggaggag
ctggggcagttcacatccctggaaggcttcaaagagctgctggacaaggcagaggtgggg
caggcttacatggagcgaccctgtctggacccccgggacccccaatgcccccccagtgcc
cccaacaagcaaagccagcagaaccccgacatcccggctgaactctcagggggctgccat
ggcttctccaggaagttcatgcgctggcagcaggagctgattttaggcggcacgaccaaa
gactcccagggcaagctgctacgcgccgaggccctgcagaccatgttcctcctcatgagc
ccccggcagctctatgagcacttcaaggatgactacgagatccatgacatcagctggagt
gaggagaaggcaggagcaatcctggaggcctggcagaggaaatttgtggagttggcacag
gactccatccctcccaacgccacacagagcgtccacgctttctccaccaccacgctcaac
gacatcatgaagtccttctctgacgtcagcgccatccgggtggctgggggctacctcctc
atgctggcctacgcctgcgtcaccatgctgcggtgggactgctccaagtcccagggggcc
gtgggcctggctggggtcctgcttgtggctctctctgttgcctccggcctggggctttgc
tcactgctgggcatctccttcaacgcagccaccacccaggtcctgcccttcctggccctc
ggcattggggtggatgacatgttcctcttggctcatgccttcaccgagaccagccagcat
gtccccttcaaggagcggacgggtgagtgtctgaaacgcacggggaccagcgtggctctc
acctctgtcagcaacatgatcgccttcttcatggcagccctggtgcccatccctgccctg
cgtgccttctccctccaggctgcagtggttgtggtgttcaacttcgccatggtgctgttt
gtgttccctgctatcctgagcctggacctgcaccgccgggagaaacgccggctcgacatc
ctctgctgcttctatagcccttgctcttcacgggttatccagattcagccgcaagagctt
gctgacgccaacgacaaccacgcctgccacccatccccttatgggcatcccagcgtggcc
accagcacccagatcaccaccaccgtgcaagccttcacccggtgcgacccctcgggccac
cacatcgtcaccgtcctgccgcccacctcccaggtgtgcacctcgcctgccgtcctcctg
ccccccagcgaccccctgggctctcaggtcttcgccccatccagctccacccgggatctg
ctggcccagctggatgaggccaagggtaggcgggagtgcgtccccctgcccttctgccgc
tggagcctcgctgacttcgcccgtgagaagtacgccccgctcctcctgcggacccggacc
aaggcggttgtggtggtgctgttcctggcactgctggggctgagcctctacggcaccacc
atggtgcacgatggcctctacctgacggacatcgtgccacgggacaccaaggcgcacgcc
ttcatctcggcccagttcaagtacttctccttctacaacatgttcattgtcaccaagggt
ggcttccactacccgggtgcccaagctgccctgctgagcctgcaccaggccttcagcacc
gtcaaatatgtggtgcgggagggaaaccgcgacctgcccaagatgtggctccattacttc
caggactggctgcgagggcttcaggccaccttcgatagggactggcaggccgggcgcatc
acccatgacagctaccgcaacggctctgaggacggggcgctggcatacaaactgctgatc
cagaccggcaacaagaaggagcccttcaacttcaatcagctgaccactcggcggctggtg
gacgagaatggcatcatcccccctgacaccttctatatctgcctgacggtgtgggccagc
aacgaccccctgggctttgccgcctcccaggccaacttctaccccccaccacctgagtgg
attcacgacaagtacgacaccacgggcgagaacctgcgaatcccagcagcccagccgctg
gagtttgcccagttccctttctacctgagtgggctgcgtcgcacgtccgacttcgtggag
gcgattgagagcgtgcgggccatctgccgggaggccgcccagcgccacggcgtgctgagc
taccccagcgggtaccccttcctcttctgggagcagtacatcggcctgcggcactggttc
ctgctggccatcagcatcctgctggcctgcaccttcctcgtctgcgccctgctgctgctc
aacccctggacagctggcatcatcgtctccatcctggccatgatggctgtggaactgttt
ggcatcatggggctgatgggcatcaagctgagcgccatcccagtggtcatcctcatcgcc
tcggtgggcatcggtgtggagttcactgttcacgtggccctgggcttcctgacagctgtg
gggagcaggaacgtgcgctcggccgcggcgctggagcacacctttgcccccgtgatggac
ggtgctgtctccaccctcctgggtgtcctcatgctggccggctccgagtttgacttcatc
atgaggtacttctttgcggtgctgaccatcctgacgctgctggggctgctcaacgggctg
gtgctgctgcccgtcctgctctcggtcgtcgggccaccccctgaggcatccctagtggat
aatggctcctgcctaaccccaccagagtcagtgcccccatgcctgggccctggggggctg
tatgtccgtcgctctccagcctggcctgccaccttccccgagccctcggacacggagcac
tacacggagggtgtggggccaagcaacccccggggacccttcattgtgccccccacccca
gcacacatccttctggaggctggcaaggaccccagcttcccccgcatcaccgtgctgaag
ccctacaaggacagcctggaggttcaggggaagaaggaggcttctggctcgcagcccaca
cccaccctgccctttggggagccgtgccccacactggcccgggaacacctgcagccctgc
ccgccgggcacccggccagcccccactgcagccctgcccacctacagcacccacctgcag
ggtcctgctggcagctacaccaccgtcacggccaccgcatcggtgacagtggccctgcac
cccacactgcctggttcctaccccagcttcagccctgagggcttcgccagcagcgagcgg
gactgcctggatgagcccagcgtgcccagtaccagcggcaccgccgtgcccgatgccttt
gagatgcagagcatgggacaccatggggcaggtgcccagcgctag

KEGG   Empidonax traillii (willow flycatcher): 114071695
Entry
114071695         CDS       T05887                                 

Definition
(RefSeq) protein patched homolog 1-like
  KO
K06225  patched 1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114071695
SSDB
Motif
Pfam: Sterol-sensing Patched MMPL Pilt DUF4012
Other DBs
NCBI-GeneID: 114071695
NCBI-ProteinID: XP_027765344
LinkDB
Position
Unknown
AA seq 619 aa
GKPPFQWINFDPLEFLKKLKKINYQVESWEEMLKKAEVGHGYMDRPCLNPADPDCPITAP
NKNSTKPLDVALVLSGGCYGLSRKYMHWQEELIIGGTVKNSSGKLVSAQALQTMFQLMTP
KQMYEHFKGYEYVSHINWSEDKAAAILEAWQRMYVEVVHQSVAENSTQKVLSFTTTTLDD
ILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCAKSQGAVGLAGIFLVALSVAAGLGLCS
LIGISFNAATTQVLPFLALGVGVDDIFLLVHAFSETGQNKRIPFEDRTGECLKRTGASVA
LTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLD
IFCCFTSPCATRVLQIEPQAYVKNRDNTCYSTPPYSSQSFVHETQITMQSTVQLHTECNP
HAQVFYTTAEPCSAISVQPVTVTQDNISCQSPESTNSTRDLLSQFSDSSMHCLKPPCAKW
TLSSFSEKHYAPFLLKPKAKIVVIFLFLGLLGLSLYGTTQARDGLNLTDIVPRETQDYDF
IAAQFKYFSFYNIYIVTQKADYPSPHVQHLLYELHKSFSNVTYILLEEDKQLPKMWLHYF
RDWLQGKRELHELFFLIIQ
NT seq 1861 nt   +upstreamnt  +downstreamnt
agggaaacctccttttcagtggatcaactttgaccccttagaattcttaaaaaagttaaa
aaaaataaattaccaagtggagagctgggaagaaatgctgaaaaaagcagaggttggtca
tggttatatggatcgaccttgtctgaatcctgctgatcccgattgtccaatcacagctcc
caacaaaaattccaccaaacctcttgatgtggctcttgttttgagtggtggatgctatgg
actgtcaagaaaatacatgcattggcaggaggaattgattataggtggtacagtcaagaa
tagttctggtaagcttgtcagtgcccaggctttgcaaaccatgtttcagttaatgactcc
taagcaaatgtatgagcacttcaaggggtatgaatatgtttcacatatcaactggagtga
ggataaggcagcagcaattctggaagcctggcagcggatgtatgttgaggttgttcatca
aagtgttgcagaaaactctactcagaaggtgctttcctttactacaactaccctggatga
cattctaaagtcattttctgatgtcagcgttatcagagtagctagtggctacttactaat
gcttgcctatgcctgtttaacaatgctgcggtgggactgtgcaaaatctcaaggtgctgt
ggggctggcaggaatcttcttggttgcgctctcagtggctgcaggactgggtctgtgctc
attgattggaatttcctttaatgctgccacaactcaggttttgccttttcttgctcttgg
agttggtgtagatgatatattccttctggtacatgcatttagtgaaacagggcagaataa
gagaattccatttgaggacagaacaggtgaatgtttgaagcgaacaggagcaagtgtagc
ccttacatctatcagcaatgttactgctttttttatggctgccttaatccctattcctgc
tttacgagcattttcactccaagcagcagttgtggtagtattcaactttgctatggtttt
gctgatttttcctgctatcctgagtatggacctttatcgtcgggaagacaggagactgga
tatattctgctgttttacaagtccgtgtgccactagagtgcttcagattgagcctcaagc
atatgtgaaaaacagggataatacttgctacagtacacccccatacagcagtcaaagttt
tgtacatgaaactcagattacaatgcagtctacagtgcagttacacacagaatgcaatcc
tcatgcacaggtgttctacaccacagcagagccttgctcagcaatatctgtgcagccagt
gacagtgacacaagataatatcagctgccagagcccagaaagcacaaactcaacaagaga
tttgctttcccaattctcagactcaagtatgcattgcctcaagccaccctgtgctaaatg
gacactctcatctttttcagaaaagcattatgctccattcctgctaaaaccaaaagctaa
gattgtggttatttttctttttctgggtttacttgggctcagcctttatggaactaccca
ggctagagatggactgaatctcacagatattgtaccacgagaaacccaggattatgattt
tattgcagcacagttcaagtatttctcattttacaatatttatatagtaacacagaaagc
agactatcctagtccccatgtccagcatttactttatgaacttcacaaaagtttcagtaa
tgtgacatacattttgttggaagaggataagcagcttcccaaaatgtggttgcactactt
tcgagactggctgcaaggtaagagagaattgcatgaacttttctttttaattatacagta
g

DBGET integrated database retrieval system