KEGG   Empidonax traillii (willow flycatcher): 114055345
Entry
114055345         CDS       T05887                                 

Gene name
CSNK1G3
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114055345 (CSNK1G3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114055345 (CSNK1G3)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114055345 (CSNK1G3)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114055345 (CSNK1G3)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 114055345
NCBI-ProteinID: XP_027735150
LinkDB
Position
Unknown
AA seq 457 aa
MENKKKDKDKPDERMARPSGRSSHNTRGTGSSNSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNDYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLG
PSLEDLFDLCGRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQI
IHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKP
DYDYLRKLFTDLLDRKGYMFDYEYDWIGKQLPTPVGSIHSDPAMSSNREAYQHRDRMQQS
KNQSTDHRAAWDSQQANPHHLRAHLAADRHGGSVQVVSSTNGELNTDDPTAGRSNAPITA
PAEVEVTDETNCQKVLNMCYVTLRAVLVCLCPLLLFQ
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggagaataaaaaaaaagacaaagataaaccagatgaaagaatggcacggcctagtggg
agatcaagccataatacgcgtggaactggttcttcaaattctggcgtgttaatggttggc
cctaacttcagagttggtaaaaaaattggatgtggtaattttggagaactacggctagga
aaaaatttatacacaaatgactatgtggcaattaaactggagccaatgaagtcgagagca
ccacagctacatttggaatacagattctacaagcagctaggatctggagatggaatacct
caggtttattattttggcccatgtggcaaatataatgctatggtgctagaactacttgga
cctagtctggaagatttgtttgacttgtgtggtaggacattttctcttaaaaccgttctt
atgatagccatacaattgatttctcgtatggagtatgtccattcaaagaacttgatatac
agagatgtaaaacctgagaacttcctaataggacgacctggaaacaaaactcagcaaatt
attcacattatagattttggtttagcaaaggagtatgtagatccagaaacaaagaagcac
ataccatatcgagaacacaagagccttacaggaacagctagatacatgagtataaataca
cacttaggaaaagagcaaagtagaagagatgatttggaagctttgggtcatatgtttatg
tattttctcagaggaagtcttccatggcaaggtttaaaggctgatacattaaaagaacgt
taccagaaaattggagacactaaacgagcaactcctatagaagtattgtgtgaaaacttc
ccagaggaaatggctacatacctacgttatgtaagaaggttagatttttttgaaaagcca
gactatgactacttaagaaagctcttcacagacttacttgatcggaaaggctatatgttt
gattatgaatatgactggattggaaaacagctgcctactccagtgggttcaatacattca
gaccctgcaatgtcttcaaacagagaagcatatcagcacagagacagaatgcaacaatcc
aaaaatcagtcaacagaccatagggcagcctgggactcacagcaagccaatccacatcat
ttgagggctcacctggcagctgacagacatggtggctcggtacaggtagtaagctcaaca
aatggagaactcaacacagatgacccaactgcaggccgttcaaatgcacccatcacagct
cctgcagaagtagaagtaacggatgaaaccaactgccagaaagtgttgaacatgtgttat
gtaactctcagagcagttctggtctgcctctgcccactgctactttttcagtga

KEGG   Empidonax traillii (willow flycatcher): 114055383
Entry
114055383         CDS       T05887                                 

Gene name
CSNK1E
Definition
(RefSeq) casein kinase I
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04068  FoxO signaling pathway
etl04310  Wnt signaling pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114055383 (CSNK1E)
   04340 Hedgehog signaling pathway
    114055383 (CSNK1E)
   04068 FoxO signaling pathway
    114055383 (CSNK1E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114055383 (CSNK1E)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etl03036]
    114055383 (CSNK1E)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114055383 (CSNK1E)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114055383 (CSNK1E)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114055383 (CSNK1E)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 114055383
NCBI-ProteinID: XP_027735236
LinkDB
Position
Unknown
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDMDRERREHEREERMGQLRGSATRALPPGPPAGATANRLRNVTEPMASTPTSRIQQSG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRISASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagcttcgagtagggaacaaataccggctgggcagaaagattggcagcggttcattt
ggagacatttacctaggagccaatattgcaactggtgaagaggtggccatcaaactggaa
tgtgtcaaaaccaagcatccccagctccacattgaaagcaagttctacaagatgatgcag
ggaggagtgggtatcccctccattaagtggtgtggagcagagggggactataatgtgatg
gtgatggagctcttggggcccagcctggaagatctcttcaacttctgttcccgcaaattt
agtctcaagacagttctgctcctggcagaccagatgatcagccgtattgagtacattcat
tccaagaacttcatccatcgggatgtaaagccagacaacttccttatgggcctcggcaaa
aaaggcaacctagtatacatcattgattttggtttggccaagaagtaccgagacgcccgg
acccaccagcacatcccttaccgggaaaacaagaatctgactggcacagcccgttatgcc
tctatcaacacccacttgggaattgaacaaagtcgccgtgatgacctggagagcctgggt
tatgtgctcatgtatttcaacctgggctcgctgccctggcagggcctcaaggctgccacc
aagcgccagaagtatgagaggatcagcgagaagaagatgtcaacacccattgaggtgctc
tgcaaagggtacccttctgagttctcaacatacctcaacttctgccgttcgctgaggttc
gatgataaacctgactactcgtacctgcggcaactcttccgcaacctcttccaccgccaa
ggcttctcctacgactacgtctttgactggaacatgcttaaatttggtgcagctcggaac
cctgaggatatggatcgggagcggcgagagcatgaacgagaggagaggatggggcaactc
cgagggtcagccacgcgagcactgccccctggcccgcctgctggagccactgccaaccgt
cttcgcaatgtcaccgagcccatggcctccacccccacctcccgaatccagcagtccggc
aacacgtcccccagagcaatctcaagagtggacagggagcgtaaggtcagcatgaggtta
caccgaggagctcctgccaacgtctcctcatctgacctcacagggcggcaagaagtgtca
cggatttcagcatcacagacaagtgtgccatttgatcaccttgggaagtga

KEGG   Empidonax traillii (willow flycatcher): 114060268
Entry
114060268         CDS       T05887                                 

Gene name
CSNK1G1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114060268 (CSNK1G1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114060268 (CSNK1G1)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114060268 (CSNK1G1)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114060268 (CSNK1G1)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 114060268
NCBI-ProteinID: XP_027745440
LinkDB
Position
Unknown
AA seq 464 aa
MDHPNRDKDERQRTTKGMPGRSGHGSRPSSSASSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAAEGLPQVYYFGPCGKYNAMVLELL
GPSLEDLFDLCDRTFTLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEH
VIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMF
MYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPVEVLCENFPEEMATYLRYVRRLDFFER
PDYDYLRTIFTELFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGTSAVTRDSHIHRDRPS
QQALRNQASSDRRGEWEIQPSRQTNTSYLTSHLAADRHGGSVQVVSSTNGELNVDDPTGA
HSNAPITAQAEVEVVEEANCLKMLNLWCCCFFKRKRKKTAQRHK
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggaccatcctaatagggataaggatgaaaggcagcggacgacgaagggaatgccggga
aggagcgggcatggttctcgaccgagctcatcggcatcttctggcgttcttatggtggga
cccaacttcagagtgggcaagaagattgggtgtgggaactttggagaactcagactaggt
aaaaatctctacaccaatgaatatgtagcgatcaaactggaaccaatcaaatcccgggca
ccacaacttcatttagaatacagattttataaacaacttggaagtgcagctgaagggctt
ccccaggtgtattacttcgggccatgtgggaagtacaacgccatggtactggagctgctt
ggtcccagcttggaagatttgtttgacctctgtgacaggacattcaccctgaagacggtg
ttgatgatcgccatccagctgatctctcggatggaatacgtgcattccaagaacctcatc
taccgagatgtgaagccagaaaacttcctcattggccggcaaggcaataagaaggagcac
gtcatccacatcatagactttggattggcaaaggagtacattgacccggaaaccaaaaaa
cacataccctacagggagcacaagagcttaactggaacggcgagatacatgtccatcaac
acccaccttggcaaagagcaaagtcgtcgagacgacttggaagccctgggccatatgttc
atgtatttcctccgaggcagcctgccctggcagggattgaaggctgacaccttaaaagag
aggtatcagaagattggcgacacaaagagaaacactccggttgaagttctctgtgagaac
tttccagaggagatggccacgtacctccgctacgttcggcgattagacttctttgagagg
ccagactacgattacctgcgaaccatcttcacagagctgtttgagaagaaaggctacacc
tttgactatgcctatgattgggtcggcaggccaattcctactcctgtgggatctgttcat
gtagattctgggacatctgcagtaacaagagacagccacatccaccgggatcgaccatcc
cagcaagcccttcgcaatcaggcatcgtcagatcgccgaggggagtgggagatccagcca
agccgacagacaaatacctcgtacctgacatctcatttggctgcggatcgacacggagga
tcagtgcaggtggtgagctcaaccaacggggagctgaacgtggacgacccgacgggagca
cactccaacgcgcccatcacagcgcaggcagaggtggaggtggtggaggaagctaactgc
ctgaaaatgctcaacttgtggtgctgctgcttctttaagaggaaacggaagaagacggct
cagcgtcacaagtga

KEGG   Empidonax traillii (willow flycatcher): 114060339
Entry
114060339         CDS       T05887                                 

Gene name
CSNK1D
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
etl04540  Gap junction
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114060339 (CSNK1D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114060339 (CSNK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114060339 (CSNK1D)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etl03036]
    114060339 (CSNK1D)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114060339 (CSNK1D)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114060339 (CSNK1D)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114060339 (CSNK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 114060339
NCBI-ProteinID: XP_027745588
LinkDB
Position
Unknown
AA seq 415 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGTSRA
AEDAERERREREERLRHTRSPAVRGLPSTASGRLRGTQDVAPPTPLTPTSHAANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPARVTTSVLQSAVHR
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggagctgagggttgggaaccggtaccggctgggccggaagatcgggagcggctccttc
ggggacatctacctgggaactgatattgctgccggagaggaggttgcaattaagctggaa
tgtgtgaaaaccaaacatcctcagcttcacatcgagagtaaaatctacaaaatgatgcag
ggtggagtgggtattcccacaattaaatggtgtggagctgaaggggactacaatgttatg
gtgatggagctgttggggccaagtcttgaagatctcttcaatttttgttcaaggaaattt
agtctcaagacagttctgctacttgcggaccaaatgattagtcgaattgaatacattcac
tctaagaacttcatccaccgagatgtgaagccggataacttcctaatgggcctggggaag
aaaggcaatcttgtctacataatagactttggactagcaaagaagtatcgagatgctcga
actcaccaacatattccatatcgtgaaaataaaaacttaacaggaactgcccgttatgca
tccatcaacactcatcttggaattgagcaatctcgcagagatgacttggagtccttgggc
tatgtactgatgtattttaacctgggctccctcccctggcagggattgaaagcagcgaca
aagaggcagaaatatgaacgtatcagtgaaaagaaaatgtctacacccattgaggttttg
tgtaaaggatatccttcggagtttgccacatacttgaatttctgccgttctttgcgtttt
gatgacaaaccggactattcttatctgaggcaattattcagaaacctcttccatcgacaa
gggttctcctatgactatgtatttgactggaacatgttaaaatttggtacaagcagagcg
gctgaagatgctgaacgtgaaaggcgagaacgagaggaaaggttaagacatacacgaagt
ccagctgtgcgtggattaccctctactgcgtctggcaggctgagaggaacgcaagatgta
gctcctcctactccccttacgccaacttcacatgctgccaacacctctcctcggccagta
tctggtatggaacgagaaaggaaagtgagtatgagattgcatcgtggagccccagtcaat
atctcctcgtccgacttaacaggccgacaagatacctctcgcatgtcaacttcgcagatt
cctgctcgggtgactaccagtgttctccagtctgctgtgcaccgatga

KEGG   Empidonax traillii (willow flycatcher): 114066728
Entry
114066728         CDS       T05887                                 

Gene name
CSNK1A1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04310  Wnt signaling pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114066728 (CSNK1A1)
   04340 Hedgehog signaling pathway
    114066728 (CSNK1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114066728 (CSNK1A1)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114066728 (CSNK1A1)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114066728 (CSNK1A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 114066728
NCBI-ProteinID: XP_027757467
LinkDB
Position
Unknown
AA seq 409 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKSKS
NMKGVRWWAWLAEKLFLRCRSSCRTQCSSSTSPSALSSLKFSLEIKSEP
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgagttcattgtcggaggcaaatacaagctggtg
cggaagatcgggtcgggctccttcggggacatctacctggcgatcaacatcaccaacggg
gaggaagttgctgtgaagttggagtctcagaaggctcggcatccccagctgctgtatgaa
agcaaactgtacaagatcctgcagggaggagttggcatcccacatatacggtggtatggt
caagaaaaggactacaatgttctagtcatggatcttcttgggcccagcctggaagacctc
ttcaacttctgttctcgcaggtttacgatgaaaacagtacttatgctagcagaccagatg
atcagtagaattgaatatgtgcacacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtacttctcaggacccatctttctcaggattaaaccag
ttattccttattgactttggtttggccaaaaagtaccgggacaacaggacaaggcaacac
ataccatacagagaagacaaaaatctcactggcacagctcgatatgccagcatcaatgca
catcttggcattgagcagagtcgtcgggatgacatggagtctctaggctatgtattgatg
tactttaacagaaccagtctgccttggcaaggattaaaggctgcaacaaagaagcaaaag
tatgaaaagattagtgaaaagaaaatgtccactcctgttgaggttttgtgtaaggggttc
cctgcagaatttgccatgtatctgaactactgtcgtggcctgcgctttgaagaggcacca
gattacatgtatctgaggcaattattccgtattcttttcaggaccttgaaccaccaatat
gactacacattcgactggacaatgttaaagcagaaagcagcacagcaggcagcctcttcc
agtgggcaggggcagcaggcccaaacccccacaggcaagcaaactgacaaatccaagagt
aacatgaaaggagtccgttggtgggcatggctggcagaaaagctgtttctgaggtgcagg
tcgagctgcagaactcagtgctcatcttccacgagccccagcgctcttagctccttgaaa
ttctcccttgaaataaagagtgagccttga

KEGG   Empidonax traillii (willow flycatcher): 114070721
Entry
114070721         CDS       T05887                                 

Gene name
CSNK1G2
Definition
(RefSeq) casein kinase I
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114070721 (CSNK1G2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114070721 (CSNK1G2)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114070721 (CSNK1G2)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   114070721 (CSNK1G2)
SSDB
Motif
Pfam: Pkinase CK1gamma_C PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 114070721
NCBI-ProteinID: XP_027764074
LinkDB
Position
Unknown
AA seq 415 aa
MDFDKRGGKGELEEGKRMSKTGGGRSGHGSRGAGTNSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNAEGIPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKR
QHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPVEVLCENFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFERNGYVFDYEYDWAGKPLPTPIGTMHSEVQVQPPNRDKAQPHTK
HQVMSSTNGELNTDDPTAGHSNAPITAPTEVEVTDDTKCCCFFKRRKRKTTKRRK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggattttgataagagaggagggaaaggggagctggaggaaggtaaaaggatgtccaag
acaggtggaggaaggagcggtcatggaagccggggcgctggaaccaactcgggagtctta
atggtgggtcccaacttccgcgtcggcaagaagatcggatgcggcaatttcggggagctc
cgtctaggaaagaacctctacaccaacgagtacgtagcgatcaaattggaacccataaag
tcccgggccccccagctgcacctggagtatcggttctacaaacagctcggcaatgcagaa
ggaattcctcaggtttactactttggcccctgcgggaagtacaacgccatggtgttggag
ctgctgggacccagcctggaagatctctttgatctgtgcgatcgcaccttcacgctcaag
accgtcctgatgatcgccatccagctgatcacacggatggagtatgtgcacaccaaaagc
ctgatctacagagatgtgaagccggagaacttcctggtggggcggccgggcagcaagcgg
cagcacaccatccacatcatcgattttggcctggccaaagagtacattgaccccgagacc
aaaaaacacatcccctaccgagagcacaagagcctgacagggacggcacgttacatgagc
atcaacacccacctcgggaaagaacaaagccgcagggacgacctggaagcattagggcac
atgtttatgtacttcctccgcgggagcctgccttggcaaggcctcaaggctgacacgctg
aaggagaggtaccagaagatcggtgacaccaaacgagccaccccggtggaggtgctctgt
gagaacttcccagaggagatggccacgtacctgcgctacgtgcggcggctggatttcttc
gagaagcccgactatgactacctgaggaagctcttcacagacctgttcgagaggaacggt
tacgtgttcgactacgaatacgactgggcagggaagcctctgcccacgcccattggcacg
atgcacagcgaggtgcaggtgcagcccccgaacagagacaaagcacagccacacaccaaa
caccaggtgatgagctccactaacggagagctgaacacagacgacccgacggcaggacac
tcgaacgcccccatcacagcccccaccgaggtggaggtgacagacgatacaaagtgctgc
tgtttcttcaagagaaggaagaggaaaaccaccaagcgtcgcaagtga

DBGET integrated database retrieval system