KEGG   Empidonax traillii (willow flycatcher): 114055514
Entry
114055514         CDS       T05887                                 

Gene name
GLI2
Definition
(RefSeq) zinc finger protein GLI2
  KO
K16798  zinc finger protein GLI2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114055514 (GLI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:etl03000]
    114055514 (GLI2)
Transcription factors [BR:etl03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    114055514 (GLI2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 114055514
NCBI-ProteinID: XP_027735542
LinkDB
Position
Unknown
AA seq 1528 aa
METSASTTAGKKEGKGAVLEGNGFTETGKKPTPLAAAGAAVAQGVPQHIFPAFHAPLPID
MRHQEGRYHYEPHSIHAIHGPPPLSGSPVISDISLIRLSPHPAGPGESPFSPPHPYVAPH
MEHYLRSVHGSPTLSVISAARGLSPADVAHEHLKERGLFGLPPPPPGANPADYYHQMTLM
AGHPNPYGDLLMQGGGAASTAHLHDYLSPVDVSRFSSPRVTPRLSRKRALSISPLSDASI
DLQTMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGTISPAFSFPHPLNPVTYQQILTQQ
RGLSSAFGHTPPLIQPSPTFPPRQHMAVISVNPPPTQISNNSNCISDSNQSKQSSESAVS
STVNPVINKRSKVKTEVEGLPPVSPNTQEHLTDLKEDLDKDECKQEPEVIYETNCHWEGC
TKEYDTQEQLVHHINNDHIHGEKKEFVCRWQDCTREQKPFKAQYMLVVHMRRHTGEKPHK
CTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPY
VCKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHPRPPPLKENGDNEASAKQSS
KVSEESHEANSTTRSVEDCLQVKTIKTENSVMCQSSPGGQSSCSSEPSPLGSTNNNDSGV
EMNMHSGGSLGDLTALDDNAPVVDSTVSSGNSAVSLQLRKHMTTMQRLEQLKKEKLKTVK
DSCSWVSPAPQARNTKLPPISGNGSVLENSGGSSATLPNPRIMELSVNEVTMLNQLNERR
DSTTSTVSSAYTVSRRSSGISPYFSSRRSSEASHLGHRPNNTSSADSYDPISTDASRRSS
EASQCSGMPGLLNLTPAQHYRLKAKYAAATGGPPPTPLPNMERMTLKNRISLMDGPDPTL
PSIRLPPGPRRCSDGNTYGYPSAPTFPHEVQGNCMRRASDPVRRPAGDPQALSRVHRFNS
TNSMNPFHPPHPTDRRNLGLQSYGRSDGSLPRHTYSPRPLSISENIAMEAMSGETEAPIG
DDDIVLPDDVVQYIKSQSNGTAAESTSMGYSNEMQNFQGSGKLQPPALPGQRRMAVAEAS
MNHLGPMMAECSMSFDTSSDMNKNNMPVQWNEVSSGTVDIMSNQSKQQFSQGNLAVVQQK
QNFGQYQNYNQQQMQLPDNGMNVTQQSFMQRNVGMDGQRLNCMQLRQQPMNLGPGMNPDV
GLHTGYNQPHHMLSPSAISGNPNQISPNCSNMAAKSGPHLHPQQMDMTTDPSLMVRSNSE
HPVLGQVMHEPSQQNYSSQPTHLNFPMAQETFHQPMMASNQPSFEPQQSMMGSAAQAYPP
GMMQPRPPPEPNPGSRARGLRTIQQLGYMRTPHPTNTTSPGQETTEAMHKRTSDMLLAPA
QQCSDGTRENNLMYYYGQIHMYEQNSSFDNHADCRVRQQQCTLNSKPAALPSPGANQVSS
TVDSQGLEPPQIDFDAIMDDGDHSSLMSGTLSPSILQNLSQNSSRLTTPRNSLTLPTIPA
GISNMAIGDMSSMLTTLAEESKFLNMMS
NT seq 4587 nt   +upstreamnt  +downstreamnt
atggaaacctctgcttcaacgactgctgggaaaaaagaagggaaaggtgctgttctggag
gggaatggctttacagagacggggaagaaacccacgcctttagcagctgcaggagcagca
gtggcacaaggagtgccgcagcacatttttccggccttccacgctcctttgccaattgac
atgcgccaccaggaaggacgataccattacgaacctcactctatccacgctatccacggg
cctcctcctctgagcggcagtcccgtcatctccgacatctccctcatccgcctgtctccg
caccccgccgggcctggcgagtcgcccttcagcccaccacacccctacgtggcaccccac
atggagcattacctccgctctgtccacggcagccccacactctccgtcatctctgctgcc
aggggcctcagccccgccgacgtggctcatgagcacctgaaggaacgaggtctcttcggg
ctgcccccaccaccaccgggagccaaccccgctgactactaccaccaaatgacgctgatg
gccggccacccaaacccctacggggacctcctcatgcagggcgggggagcagccagcaca
gcacacctccacgattacctcagccccgttgatgtgtcccggttttcgagcccgcgggtg
actccaaggttaagccgaaaacgagccctatctatctccccactgtctgatgccagcatt
gatctccagacaatgatcaggacctccccaaactctctcgtggcgtacatcaacaactcc
agaagcagttcagcggcgagtggctcctacggccatttatctgccgggacaatcagtcca
gcattcagcttcccccatccccttaaccccgtgacataccagcagatcctgacccaacaa
agaggcctgagctcagccttcgggcacactcctcccctgatccagccgtccccaaccttc
cccccacggcagcacatggcagtgatctccgtcaacccaccgccaacacagatcagcaac
aacagcaactgcatctctgactccaaccagagcaagcaaagcagcgagtcagccgtgagc
agcaccgtcaatccagtaattaacaaacgcagcaaagtcaagactgaagtggagggcttg
cccccagtgtccccaaacacacaggagcatctgacagacctgaaagaagatctagataag
gatgaatgtaaacaggagcctgaggtgatttatgagactaactgtcactgggaagggtgc
acaaaggaatatgacactcaagagcagctcgtccatcacatcaacaacgatcatatccat
ggggagaagaaggagtttgtctgccgctggcaggactgcacacgggagcagaagcccttc
aaggctcagtatatgttggtggtgcacatgcgaaggcacacgggagagaagccacacaag
tgcacgtttgagggctgctctaaggcctattcccgcctggagaacttaaagacacacctg
aggtcccacactggagaaaaaccctatgtctgtgaacatgaaggctgcaataaagccttt
tccaatgcctcagacagagccaagcaccagaacaggacgcattccaatgagaaaccctac
gtctgtaagatccccggctgcacgaagcggtacacggaccccagttccctcaggaaacac
gtcaagacggtgcacgggcctgacgctcacgtcacgaagaagcaacgcaacgacgttcac
ccaaggccacctccactcaaggaaaatggggacaatgaggcgagtgccaagcagagcagc
aaggtttcagaggagagccacgaggccaacagcaccacaaggagcgtggaggattgctta
caagtcaaaacgataaaaacggagaattctgtgatgtgtcagtccagtcctggtggccag
tcgtcatgcagcagtgagccgtcaccccttggcagcaccaacaacaatgacagtggagta
gaaatgaacatgcacagcgggggaagtctgggagatctgacggcgttggatgacaacgct
cctgttgtggactcaacggtgtcttctggtaattcagcagtcagcctgcagctaaggaaa
cacatgacaacaatgcaacgacttgaacagctcaagaaagagaaactcaagacagttaag
gattcctgctcatgggtgagcccagctccacaagccagaaacaccaagctgcctcccatc
tcaggaaacggctctgttctggaaaatagtggtggttcttctgctacgctgcctaatccc
agaataatggagctgtctgtcaatgaggttacaatgctgaaccagctcaacgagcgccgt
gacagtacaacaagcaccgtcagctctgcctacaccgtcagccgcaggtcatcaggaatc
tccccgtacttctccagccgccgttccagtgaggcttcgcacctcgggcaccgtcccaac
aacaccagctctgccgactcctatgaccctatttcgacagacgcctcccgccggtcgagc
gaggcgagccagtgcagcgggatgccaggtctgctgaacctcacaccagctcagcactac
aggctgaaagccaagtacgctgctgccacagggggccctcctccgactcccctgccgaac
atggagagaatgacactgaagaacaggatctcacttatggatggaccagaccccaccttg
ccctccatccgcctcccaccaggcccgaggcgttgcagtgatggtaacacctatggctac
ccatcagctccaacatttccccacgaggtgcagggcaactgcatgagacgggcaagcgac
ccagtgaggagacctgctggagacccccaggccctctcacgagttcaccgcttcaacagc
accaatagcatgaaccccttccatcctccacaccccacagacaggaggaatcttggtctc
cagagctacgggcgctcagacgggagcctgccccggcacacctactcacccagaccactg
agcatcagtgaaaacatcgccatggaagccatgtctggggagactgaggcacccattgga
gatgacgacattgtgctgccagatgatgtggtacagtacatcaaatcccagagcaatggg
acagcggccgagagcacatccatggggtacagcaatgagatgcagaacttccagggaagc
gggaagctgcagcctccagctttgcccggccagcgcaggatggcagtggctgaggcaagc
atgaaccatttgggacccatgatggcagagtgctccatgagttttgatacttcctcagac
atgaataaaaataacatgcccgtccagtggaacgaagtcagctcagggacggttgatatc
atgtctaatcagtcgaagcagcagttttcacaagggaacttagcggtggtgcagcagaag
cagaactttggtcagtaccagaactacaaccagcagcaaatgcagctgccagacaatggt
atgaatgtaacacagcagagctttatgcaaagaaacgtgggcatggatgggcagaggcta
aactgtatgcagctgcggcagcagccaatgaatctaggcccaggtatgaaccctgatgtg
ggcttgcacacagggtataaccaacctcatcacatgctgagtcccagtgcaataagtggc
aacccaaatcagatctctcctaattgtagcaacatggcagcaaaatctggaccccacctt
caccctcagcaaatggacatgacgactgacccttctttgatggtcaggagcaacagtgag
cacccagtgctgggacaggtcatgcatgaaccgagtcagcagaattactcatctcagcca
acccacctgaacttccccatggctcaagagaccttccatcagcccatgatggcctccaat
cagcccagctttgagcctcagcagagcatgatgggttcagctgctcaggcatatccgcct
ggtatgatgcagcctcgtcctccacctgagccaaacccgggcagcagagcccgaggcctc
cgcaccatccagcagctggggtacatgagaactccccatcctacaaacaccaccagccca
ggccaggagacgacagaggccatgcataaaagaaccagtgacatgttgctggcgccagcg
cagcagtgctcggacggcacaagggaaaacaatttgatgtactattacggtcaaatccac
atgtatgaacagaacagcagctttgataaccacgcggactgccgagtcaggcagcagcag
tgcacgctgaacagcaagccagccgctctgccttccccaggtgcaaaccaggtgtccagc
acagtggactctcaaggtcttgagcctccccagatagattttgatgccatcatggatgat
ggggaccattcaagcctgatgtcgggaaccctgagccccagcatcctgcagaacctctcc
cagaactcctctcgcctgacgactccacgaaactctctgacactgcccaccatacctgca
gggataagcaatatggcaataggtgatatgagctccatgctaaccacgctggcggaagag
agtaaatttctaaacatgatgtcataa

KEGG   Empidonax traillii (willow flycatcher): 114067160
Entry
114067160         CDS       T05887                                 

Gene name
GLI3
Definition
(RefSeq) transcriptional activator GLI3 isoform X1
  KO
K06230  zinc finger protein GLI3
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114067160 (GLI3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:etl03000]
    114067160 (GLI3)
Transcription factors [BR:etl03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    114067160 (GLI3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 114067160
NCBI-ProteinID: XP_027758225
LinkDB
Position
Unknown
AA seq 1574 aa
MEAQSHSSATTEKKKVENSIVKCSSRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITM
QPQGGQGLGKISEEPSTSSEERASLIKKEIHGSISHLPEPSVPYRGTLFTMDPRNGYMDP
HYHPPHLFPAFHPPVPIDARHHEGRYHYEPSPIPPLHVPSALSTSPTYPELPFLRISPHR
NPAAASESPFSTPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEYYHQ
MALLAGQRSPYADIIPSAATAGAGALHMEYLHAMDSTRFPSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPPTPVSLQQM
HQQIISRQQTLGSAFGHSPPLIHPAPTFPTQRPIPGIPSVLNPVQVSSGPSESTQNKPTS
ESAVSSTGDPMHNKRSKIKPDEDLPSPGAGSMQEQPEGMTLVKEEGDKDESKQEPEVVYE
TNCHWEGCSREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRR
HTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNR
THSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDPGSH
SQTRSPGHQTQGAIGEQKDLSNTTSKREECLQVKAVKSEKPMTSQPSPGGQSTCSSEQSP
ISNYSNNGIELTLTGGGSVGDLSVIDETPIMDSTISTATTALGLQARRNMTGTKWMEQVK
LERLKQVNGMLPRLNPVPPSKAPTLPPLIGNGTQSNSSCSVGGSMTILPNRNELSSTDIT
VLNMLNRRDSNTSTISSAYLSSRRSSGISPCFSSRRSSDASQAEGRPQNVSVADSYDPIS
TDASRRSSEASQCDDLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRMAL
LGDCRESGLSPLPPVNAPRRCSDGGANGYSRRHFLSQDALGNGTRRASDPVRMVSDNLSV
PRVQRFNSLNSFNPPALPPSMEKRNLVLQNYTRSEGGIFRGFNSPCPPSISENVALEAAT
MEAGGSLNDEDLLPDDVVQYLNSQNQSMYDHLLNNVLDGNKMHHSSVLGNSNPSNFDQAS
PPSSQQGGPEANKSDLPIQWNEVSSGSSDLSPSKLKCSQRSAVQQARAFRLYNNMMVQQQ
NPERGNMAPQNGYQNLVENSSSYSLQQNMVLGSGAGTSFSMQSNKPYSESIGRQAMMSGA
TDNSCGMAVQGQKLRVGNMPVSGNQQNFIHPTASSDQATNMANEMQNRNMMEQEYLQNQP
AGEGVHYQGVNQSGQMMLGRVSPTSQSSLYQGPQSCPPVSHTIGSQPSALPVAKSYQPCS
NYSSNRRQNVLRNNLSQQQGHVSDGNQTYRVNTIKMEMQGQSQQFCSNVQNYSGQLYDQT
TGFSHQAMKTGSFFGSEANCLLQGIATENSPELLSPGANQVSSTVDSIDSNSLEGVQIDF
DAIIDDGDHASLISEALSPSIIQDVSRNSSRLTTPRASLTFPAMPVSTTNMAIGDMSSLL
TSLAEESKFLAVMQ
NT seq 4725 nt   +upstreamnt  +downstreamnt
atggaggcgcagtcccatagctctgccactacggagaagaaaaaagtggagaattccatt
gtgaaatgctccagtcgaacagatgtcagtgagaaagctgttgcctccagcacaacttcc
aatgaggatgaaagtcctgggcagacctatcacagagagagaaggaacgcgatcacaatg
cagccgcagggtgggcaaggcctcggcaagatcagtgaagagccttccacgtcgagcgag
gaaagggcctcattaatcaagaaggagatccatggatctatatcgcaccttcccgaacct
tctgtaccttaccgcgggacgctctttaccatggacccccgaaacggttacatggaccct
cattaccatcctcctcacctctttccagcattccaccctcctgtgccaattgatgcaaga
catcatgagggacgctaccattatgaaccatctcccattcctcctcttcatgtgccttct
gccttatctaccagcccgacatacccagaacttccattccttagaatttccccgcaccga
aatcctgctgcagcatcggaatctcccttcagcacccctcacccatacattaacccctac
atggactacatcaggtccctgcacagcagcccatccctctccatgatctcagcagcccgt
ggactcagcccaacagacgctccacatgctggcgtcagtccagctgaatattatcatcag
atggctctgttggcaggccagcgcagcccgtatgcagacatcattccttcagctgccact
gcaggagccggtgctcttcatatggaatatcttcatgccatggatagcaccaggtttccg
agcccaaggttgtcagccagaccaagccgaaagcgcacgttgtccatatcccccctatct
gatcacagcttcgaccttcagaccatgatccggacgtctccaaattccttggtcacaatt
ctcaataactctcgtagcagttcgtcagccagtggttcttacggccacttatctgcaagt
gcaataagccctgctctgagtttcacataccctcctacaccagtatccctccagcaaatg
catcagcaaattataagtcgtcagcaaaccctaggttcagcctttggacacagccctcca
ctcatccatcctgctccaacttttcctacccagaggcctatccccggcatccccagtgtc
ctgaaccctgtccaggtcagctctggaccttctgagtccacacagaataaacccacaagc
gaatctgcagtgagcagcacaggagatcccatgcacaacaagcgctccaagataaagcct
gatgaggacctccccagcccgggagcaggaagcatgcaggaacagccagaaggaatgacc
ctggtaaaagaggaaggggacaaagatgaaagcaaacaggagcctgaagtggtctatgag
acaaactgccactgggaaggctgttctcgggagtttgacacgcaggaacagctagtgcat
cacatcaacaacgaccatatacatggggagaagaaagagtttgtgtgtcgatggctggac
tgttcccgggagcagaaaccattcaaagcccagtatatgctggtggtccacatgaggaga
catacaggggaaaagccacacaaatgcacttttgagggttgtacaaaggcctactccaga
ctagaaaacttgaaaacgcacttgagatctcacactggagagaaaccgtatgtgtgcgaa
cacgaaggctgcaacaaagctttctccaatgcatccgacagggccaagcaccaaaacagg
actcattccaatgagaaaccatacgtttgcaagataccgggctgcacaaagcgctacaca
gaccccagttctctccggaaacacgtgaagacggtgcacggcccggaggcacacgtcacc
aagaagcagcggggagatatccacccgaggcctccgccaccaagagacccaggcagccac
tctcagactcggtcaccaggccaccagactcagggtgcaatcggtgagcagaaggacctc
agcaacactacctcaaagcgtgaagaatgcctccaagtgaaagcggtcaagtcggaaaaa
ccaatgacatctcagccaagccctggtggtcagtctacatgcagcagcgaacagtccccc
atcagcaactattccaacaatgggatcgagcttactctgaccggtggtggtagtgtagga
gacctcagtgtcatcgacgaaaccccaatcatggactctaccatttccacagccaccaca
gcacttggcttacaggccaggaggaatatgacagggaccaaatggatggagcaagtgaaa
ctagaaaggttgaaacaagttaatggaatgcttccaagactgaaccccgttccaccttcc
aaagccccgaccttgccgcctctcataggaaatggtacccagtcgaacagcagctgcagt
gtaggaggatccatgactattctgccaaacaggaacgaactttcaagcacggacatcact
gtgttgaacatgctgaacaggagggacagcaacactagcacaatcagttcagcctacctg
agcagccgcaggtcctctggaatctcaccttgcttctccagccggaggtccagcgatgcc
tcgcaggctgagggaagaccacagaacgtgagcgttgcagactcctacgaccccatctcg
acggatgcctcccggcgctccagtgaagcgagccagtgtgatgacctgccaagtcttctc
agcctcaccccagcccagcaatacaggctgaaagctaaatatgcagcagctactggtgga
cccccaccaactccactgcctaacatggagaggatgagcctcaaaacaaggatggcactc
ttgggtgactgcagggagtcaggattatctccgctgcctccagtgaatgcccctcgaaga
tgtagtgatggtggggcaaatggttacagcaggaggcattttctgtctcaagatgcttta
ggaaatgggacaaggagagccagtgatccagtaagaatggtctctgacaacctctctgtc
cctagagtccagcgtttcaacagtcttaatagctttaaccctcctgctttgcctccatcc
atggaaaagcgcaaccttgttcttcagaactatacccgttctgaaggtggcatcttccgt
ggcttcaactccccctgtcctccaagcatcagcgagaacgtcgccctggaagctgctacg
atggaagcaggtggcagtctgaatgatgaggatctcctgccagatgacgtggttcagtat
ctgaattcccagaaccagagcatgtacgaccacctgctgaacaatgtcctagacggcaac
aaaatgcatcacagctcagttttaggaaacagcaaccccagcaactttgaccaagcctct
ccaccaagcagtcagcagggaggtcccgaggcaaataagagcgacttgcccattcagtgg
aatgaagtaagctcaggaagttctgacttatctccttcaaagctgaaatgcagccagagg
tcagcagtgcagcaggctcgggccttcagactgtacaacaatatgatggttcagcagcag
aacccggagagaggcaacatggccccgcagaatggctatcagaacctagtggagaacagt
agttcctacagtttacagcaaaacatggttctcggcagcggagccggtacttctttcagc
atgcagtccaataagccctacagtgaaagcattggcaggcaagcaatgatgtctggggcc
acggacaattcctgtggcatggcagtgcaagggcagaagctgagagtcggtaacatgcca
gtgagcggaaaccagcagaatttcatccatcccacggcatctagcgatcaagccaccaat
atggcaaacgagatgcagaacaggaatatgatggaacaggaatatttgcaaaaccaacca
gctggagagggtgttcattaccagggagtcaatcaatccggtcaaatgatgctagggcgg
gttagtcctacctcacaaagcagcctgtatcaaggaccgcagagttgtccaccggtgtct
cacaccattggtagccagccttcagctttgccagtggccaaaagttaccagccatgctct
aattacagcagcaacagacggcagaacgtattgagaaacaacctgtcgcaacagcaagga
cacgtaagtgatggcaaccagacctacagggtaaacaccattaagatggagatgcaaggt
caatcacagcagttctgctctaacgtgcagaattactctggtcagttatatgaccaaacc
acaggctttagccaccaagctatgaaaacaggttctttctttggttcggaagctaactgc
ctgctgcaggggattgcaactgaaaactcacctgagcttctttccccgggggctaaccaa
gtgtcaagcacagttgacagcattgacagcaacagtctagagggtgtgcagattgatttt
gatgctatcatagatgatggggaccatgccagcctaatttcggaagccctgagcccaagt
atcattcaagatgtctcccgcaattcctcacgcctcaccactccccgagcatctcttaca
ttcccggctatgcctgtaagcacaactaacatggctattggggacatgagctctttgttg
acctcgcttgcagaagaaagcaagtttcttgctgttatgcaatag

KEGG   Empidonax traillii (willow flycatcher): 114071280
Entry
114071280         CDS       T05887                                 

Gene name
GLI1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114071280 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:etl03000]
    114071280 (GLI1)
Transcription factors [BR:etl03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    114071280 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 114071280
NCBI-ProteinID: XP_027764873
LinkDB
Position
Unknown
AA seq 1279 aa
MFDPAGPPAAGYSEHCCLRPPHGPAPAAPGPPGLDFPVCHQPGHRGYGLAPGAEHPGDGS
RFSTPRGVGKLGKKRALSISPLSDSSIDLQTVIRTSPNSLVAFINSRCASAGGSYGHLSI
STISPSLGYQSPPGQQKGQGHLYTTPPPCSSHEHLPTRPGLLHHPPARGALKHCQQLKLE
WSLSSPLSARFPEERSEGDISSPASTGTQDPLLGMLDVREELEKEDGKPECEAVYETNCY
WDGCAKEFDTQEQLVHHINNEHIHGEKKEFVCHWAACSREQRPFKAQYMLVVHMRRHTGE
KPHKCTFEGCNKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSN
EKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKHRGDVGPGRALPTPSAPPDMKQ
EKDTNGPGEARKDDGKLLVPDLALKPQPSPGGQSSCSSDHSPLGSTTNNDSGVEMAGNAG
GSYEDLSTLEDVVPGEPMGTSGLMALHKLENLRIDKLKQLRKPAASKGLNLPPIPGAGLP
GEVPGLPVPPPASHRRIAELSAAELGLAALGERRSSGTSTVSSAYTVSRRSSLVSPYPPC
PGGGEGAAMPGGACPADGYDPTASPDGSRRSSGASLCGGLPGVGSLTPAQRYRLKAKYAA
ATGGPPPTPLPGVERAALGGHGAVPPGYPAPAGPRGVPNGLLRRHSSNEHPGYPGSVPPH
LAPRHGARRASDPARSAAKPPAVPRVQRFKSVGNVSVPGAGRTALQPLGGSEANLQRHGF
SPRPPSITENVFLESVGGPGPEPGLLEMEQYLGYPEESFPCPGTGVELQGGIYGAQRTVG
GTPGDVEEGLLQAEFSLPPCQMNQHFPALPAGNGAVAVPWEGPPQGTLDISSGQSVSAAT
MSGPHCPHQSGQYPHPGSCGQHPKLASPCQDGGFSGGHRSYRLQIKSEQRYPAPAPALAP
CPGTKLTGPPPPPPAFGHAMDVGPGGYPPAGPAPSGYVGIASPGARRAQTPTLQTKEVMV
RSYVEAQQALMWGEQPPPKGGASGTGLGGEPGQCQAVPAPPYLSPRYCGYQPKPDHLPGL
AEPQHLLNPPCFNPEMVPHPPGGPKPPGHPANLSYAGSLAQPGHGYDGLDTGSRHLLRLP
PARPMPEGPGNPLGYYPGQSTHGQGGKGGHKLLGQVAASCGGPGHYGGSSEGLKGTSCYY
LDSGEQVSNSLDSLDLENTHLDFAAIVEDEETPPALPGPPSPAGGLLLPSPGGANMAVGD
MSSMLSTLAGESHFLNSLS
NT seq 3840 nt   +upstreamnt  +downstreamnt
atgttcgaccccgccggacccccggccgccggctacagcgagcactgctgcctgcgcccc
ccccacggacccgcccccgccgccccgggaccaccaggcctggatttccccgtgtgccac
cagcccggccaccgcgggtacgggctggcaccgggggccgaacaccccggtgatggctcc
cggttctccacgccccgcggtgtggggaagctggggaagaagcgggcgctgtccatctcc
cccctgtccgactccagcatcgacctgcagaccgtgatccgcacctcccccaactccctc
gtcgccttcatcaactcccgctgcgcctccgccggcggctcctacggccacctgtccatc
agcaccatcagcccgtccctggggtaccagagcccgcccgggcagcagaagggccaaggt
cacctgtacacaaccccccctccctgcagctcccacgagcacctgcccacgcgcccgggg
ctcctgcaccacccacccgctcgtggggccctcaaacactgccagcagctgaagctggag
tggagcctgagcagccccctgagtgccagattcccagaggagcgatccgagggtgacatc
tccagcccagcgtccacaggcacccaggaccccctgctgggcatgctggatgttcgggaa
gagctggagaaggaggatggaaaacccgagtgcgaggccgtgtatgagaccaactgttac
tgggacggctgtgccaaggagttcgacacccaggagcagctggtgcaccacatcaacaac
gagcacatccacggggagaagaaggagttcgtgtgccactgggcagcgtgttcccgggag
cagaggcccttcaaggcccagtacatgctggtggtgcacatgaggcgtcacacgggcgag
aaaccccacaagtgcacgtttgagggctgtaacaaggcctattcccgcctggagaacctc
aagacccacctgcgctcgcacacgggggagaagccctacgtgtgtgagcacgagggctgc
aacaaggccttttccaacgcctccgaccgcgccaagcaccaaaaccgcacccattccaac
gagaaaccgtacgtctgcaagatccccggctgcaccaagcgctacaccgaccccagctcc
ctgcgcaagcacgtcaagacggtgcacggccccgacgcccacgtcaccaagaagcaccgg
ggggacgtggggccgggccgggcgctgcccacccccagcgcccccccggacatgaagcag
gagaaggacacgaacggccccggcgaggcccgcaaggacgacgggaaactcctggtgccc
gacctggccttgaagccgcagcccagcccgggtgggcagtcctcgtgcagcagtgaccac
tcccccctgggcagcaccaccaacaacgacagcggcgtggagatggcaggaaacgccggt
ggcagctacgaggacctgtccacactggaggacgtggtgcccggggagcccatgggcacc
tcggggctcatggccctgcacaagctggaaaaccttcgcatcgacaagctgaagcagctg
aggaaaccggcggcttccaagggcctgaacctgccccccatccctggagccggcctgccc
ggggaggtgcccgggctcccagtgccacccccggcctctcaccggcgcatcgcggagctg
tcggcggccgagctggggctggcggccctgggcgagcgccggagcagcggcaccagcacc
gtcagctccgcctacaccgtgagccgccgctcgtccctggtgtccccgtacccaccgtgc
ccgggcggcggcgagggggccgcgatgcccggcggggcctgcccggccgacggctacgac
cccacagcgtcccccgacgggtcgcggcgctccagcggtgccagcctgtgcgggggcctg
ccgggcgtgggcagcctcaccccggcccagcgctaccgcctcaaggccaagtacgccgcg
gccacgggcgggccccccccgacccctctgcccggcgtggaacgggcagccctgggcggg
cacggcgccgtgcccccgggataccccgcgcccgccgggccccgcggcgtgcccaacggg
ctgctgcgaaggcacagctccaacgagcaccccggctacccgggcagcgtgccccctcac
ctggcgccccggcacggcgcccggcgggcgagcgaccctgcccggagcgcggccaagcct
ccggccgtgcccagggtgcagcgcttcaagagcgtgggcaacgtgagcgtgccgggcgcg
ggcaggacggcgctgcagcccctgggcggctccgaggccaacctgcagcgccacggcttc
tccccgcggccccccagcatcaccgagaatgtcttcctggagagcgtggggggccccggc
cccgagcccggcctgctggagatggagcagtacctgggctatcccgaggaaagcttcccg
tgcccgggcaccggcgtggagctccagggcggcatctacggcgctcagcggaccgtgggg
ggcacgcccggggacgtggaggaggggctgctgcaggccgagttctccctcccgccgtgc
cagatgaaccagcacttccccgctttgccagctgggaacggggccgtggcagtgccttgg
gaaggacccccccagggcacgctggacatcagctccggtcagagcgtcagcgctgccacc
atgtccgggccgcactgtccccatcagagcggccagtacccccaccccggttcctgtggg
cagcaccccaaactggccagcccgtgccaggacggcggattttccggggggcaccggtcc
taccgactccagatcaaatccgagcagcgatacccggcgcccgccccagcacttgctccc
tgccctggcaccaaactgaccgggcccccaccgccccccccggcctttggtcacgccatg
gacgtggggccgggcgggtacccccctgcgggaccggcacccagtgggtacgtgggcatc
gccagccccggcgcccgcagagcccagacccccaccctgcagaccaaagaagtgatggtc
cggagctacgtggaggcccagcaggcgctgatgtggggggagcagcccccccccaaggga
ggggcatccggcacagggctgggcggcgagcccgggcagtgccaggccgtgccggcacca
ccgtacctcagccccaggtactgcggctaccaacccaaacccgatcacctgccgggcctg
gcggagccccagcacctcctgaaccccccctgcttcaaccccgagatggtcccacaccct
ccaggtggcccgaagccgccgggtcacccggccaacctgagctacgcgggcagcctggca
cagccagggcacggctacgacgggctggacaccggctcccggcacctgctgcgcctgccc
cccgcccgccccatgcccgaggggcctggcaaccccctggggtactacccgggccagagc
acccacgggcagggcggcaaaggcgggcacaagctgctgggccaggtggcagcgagctgt
gggggccccgggcactacggggggagctcggagggactcaaaggcacctcctgttactac
ctggactcgggggagcaggtgtccaacagcctggactccctggacctggagaacacgcac
cttgacttcgctgccatcgtggaggacgaggagacccccccggcactgcccggccccccc
agcccggccggggggctcctgctgccctccccggggggtgccaacatggcagtgggggac
atgagctccatgctgagcacgctggcaggggagagccacttcctcaactccctgtcctaa

DBGET integrated database retrieval system