KEGG   Empidonax traillii (willow flycatcher): 114055892
Entry
114055892         CDS       T05887                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04060  Cytokine-cytokine receptor interaction
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl04217  Necroptosis
etl05164  Influenza A
etl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114055892 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114055892 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114055892 (FAS)
   04217 Necroptosis
    114055892 (FAS)
   04115 p53 signaling pathway
    114055892 (FAS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    114055892 (FAS)
   05168 Herpes simplex virus 1 infection
    114055892 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:etl04050]
    114055892 (FAS)
   04090 CD molecules [BR:etl04090]
    114055892 (FAS)
Cytokine receptors [BR:etl04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   114055892 (FAS)
CD molecules [BR:etl04090]
 Proteins
  114055892 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 114055892
NCBI-ProteinID: XP_027736293
LinkDB
Position
Unknown
AA seq 362 aa
MARGLLPLLLVAVLIIEAQCKNDTEDLMHINYNRRIIARREINCKEDEYNLDGQCCKKCK
SGFVKNITCPTDIGKHCAQCESGKEYINHLNDLTECRRCSSCDRVFGLEVVKNCTPEEDT
ECACVKNHFCSSVACTECTECAACENGVIEKQCTSTSNTVCGIKETGMPLWPIALLAVLA
PLAIVGAIFWWKRKQKGLTAKDNLSKVVSKVEPSCESVPLIDTDADLSSHIAGIVEEMTF
QQVLTFIRHHRVPEPAIDQAVRDCPGDTSEQKIRLFRTWYQRHGIKGAYGTLVSSLRQLK
MCAAADKIEEKLKAAVSSCQEGRRSYNGDTEQSKTCTQEGRNSSNDSAEQSKTYAGNLEE
TA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggctcgggggctccttcccctgctcctcgtggctgtcttaattattgaagcacagtgc
aaaaacgatactgaagatctaatgcacataaattacaacaggaggatcattgccaggagg
gaaattaattgtaaagaggatgaatacaatttagatggtcagtgttgtaagaaatgtaaa
agtggttttgttaaaaatatcacctgcccaacagatattggcaaacactgtgctcagtgt
gaaagtggaaaggaatacataaatcacctcaatgatttgactgagtgtaggagatgctct
tcatgcgaccgcgtatttggtttggaggtggtaaagaactgtaccccagaagaggacaca
gaatgtgcctgtgtaaagaaccatttttgcagttctgtagcatgtacggagtgcactgaa
tgtgccgcatgtgaaaatggcgtgattgaaaaacaatgtacttcaacttcaaacactgtg
tgtggaataaaagaaacaggaatgccgctgtggcccattgctttgctagctgtgctagca
ccactagcaatagttggagcaatattctggtggaagagaaaacagaagggtcttacagcc
aaagataatctaagtaaagtagtatccaaagtagagccttcttgtgagagtgtacctctg
atagacacagatgctgacctgagcagccatattgctggtattgtggaggagatgacattc
cagcaggtcttgacattcattcgtcatcaccgtgtaccagaacctgccatagatcaagct
gttcgggattgtcctggtgatacatctgaacagaagattaggctctttcgaacctggtat
caacgtcatgggataaaaggagcctatggaaccctagtaagcagtctaagacagttaaaa
atgtgtgctgcagctgataaaatcgaggaaaaactgaaggcagctgtttccagctgtcag
gaggggagacggtcttataatggtgacactgagcaaagcaaaacctgcactcaggaaggt
agaaattcttccaatgatagtgctgagcaaagtaaaacatatgctggtaatttggaagag
acagcatag

DBGET integrated database retrieval system