KEGG   Empidonax traillii (willow flycatcher): 114056383
Entry
114056383         CDS       T05887                                 

Gene name
CCNB2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
etl04114  Oocyte meiosis
etl04115  p53 signaling pathway
etl04218  Cellular senescence
etl04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114056383 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114056383 (CCNB2)
   04114 Oocyte meiosis
    114056383 (CCNB2)
   04115 p53 signaling pathway
    114056383 (CCNB2)
   04218 Cellular senescence
    114056383 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    114056383 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:etl03032]
    114056383 (CCNB2)
   03036 Chromosome and associated proteins [BR:etl03036]
    114056383 (CCNB2)
DNA replication proteins [BR:etl03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    114056383 (CCNB2)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    114056383 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 114056383
NCBI-ProteinID: XP_027737359
LinkDB
Position
Unknown
AA seq 401 aa
MALPAARRVPVTRGMENAVSDLKSKAKTHLPGRRAALEEIGNKVATRGTRLTKRTECPKA
SIKPVKGPSRTTNGTVLHKAPAAVNQVIKETVVPKALSPVPMDVSMQEEDLCQAFSDVLL
NNVEDIDAEDSENPQLCSDYVKDIYLYLRELELQQSVRPHYLDGRIINGRMRAILVDWLI
QVHSRFHLLQETLYMCVALIDRFLQSHPVPRKKLQLVGVTAMLVASKYEEILCPEVADLV
YITDNAYTSSEIREMEMIILKELNFDLGRPLPIHFLRRASKAGEADATQHTLAKYLMELT
LIDYDMVHHRPSEIAAAALCLSQKILGHDKWGTKQQYYTGYAEDSLLMTMKHMAKNVVKV
NEKLTKYTAVKNKYASSKLLMISTIPQLSSEIIKDLAASLL
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcgctgcccgcggcgcgacgcgtgcccgttactagagggatggagaatgctgtgtct
gaccttaaaagtaaagcaaaaactcaccttcctggcagaagggctgccttggaagaaatc
ggaaataaagttgccacaagaggaacacgcctaaccaagagaacagaatgccccaaagca
tccataaaacccgtgaaaggacctagcaggaccacaaatggaactgtactgcataaagct
ccagctgctgtgaatcaagtcattaaagaaaccgttgttccaaaggctttgtctcctgtc
cctatggatgtatccatgcaagaggaggatttgtgccaagccttctctgacgtgttgctc
aacaatgtggaagacattgatgctgaggactcagagaatccccagctgtgcagtgactat
gtcaaggacatctacctgtatctgagagagcttgagctgcagcagtctgtccgcccccat
tacctggacgggaggatcatcaacgggcgcatgagagcaatcctggtggactggctgatc
caggtccactcgagattccacctcctgcaggagacgctgtacatgtgtgttgcactcata
gatcgcttcttacaaagtcatccagtacctcgcaagaagcttcagctggtgggtgttaca
gcaatgcttgttgcttcaaaatacgaagagatattgtgtcctgaggtagcagacttggtt
tacattactgacaatgcctacaccagcagtgaaataagagaaatggagatgattattctt
aaagaattgaactttgacttggggcggcctcttccaattcacttcctaagaagagcatca
aaagctggggaggctgatgctacgcaacatactctggcaaaatacctgatggagctgaca
ctgatagactatgacatggtccaccatcgtccttcagaaattgcagctgctgcattatgc
ttgtcccaaaagatcctgggacatgacaaatggggcacaaagcaacaatactacactggg
tatgcagaagacagtctcctgatgactatgaaacatatggccaagaacgtggtcaaagta
aatgagaagttaacaaaatacactgctgtaaagaacaagtatgcaagcagcaaactcctg
atgatcagcaccatccctcagctgagtagtgagataatcaaggacctggctgcatcactc
ctatga

DBGET integrated database retrieval system