KEGG   Empidonax traillii (willow flycatcher): 114057246
Entry
114057246         CDS       T05887                                 

Gene name
SESN3
Definition
(RefSeq) sestrin-3 isoform X1
  KO
K10141  sestrin 1/3
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114057246 (SESN3)
SSDB
Motif
Pfam: PA26 CMD PEX11
Other DBs
NCBI-GeneID: 114057246
NCBI-ProteinID: XP_027739090
LinkDB
Position
Unknown
AA seq 495 aa
MNRLGSGPVGSAAAAAAGQYRVCGNCRKVPRQEKRVQVSPPLTRGPSAFIPENEVMQANG
LDERTNLLVEEYSTSGRLDNITQVMSIHTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIM
AAARHQCSYLINMHVDEFLKTGGIAEWLNGLEYIPQRLKNLNEINKLLAHRPWLITKEHI
QKLVKTGENNWSLPELVHAVVLLAHYHALASFVFGSGINPERDPETSNGVRLIAVNNFCV
CDLANDNNIENASLTSSNFGNVMVFLQIADSLSELEALMERMKRLQEDKEDEEASQEEMA
TRFEKEKKESLLVISGAFDDEIVSTDVSRYIEDPGFGYKDFARRGEDHLPTFRAQDYTWE
NHGFSLVNRLYSDIGHLLDEKFRMVYNLTYNTMATHEDVDTTTLRRALFNYVHCMYGIRY
DDYDYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQ
AELLYALRAITRHLT
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgaaccgcctcggctccgggccggtgggcagcgccgccgccgctgccgccgggcagtac
cgggtgtgcggcaactgccggaaggtgccgagacaggaaaagagagtacaagtctccccg
ccactgacaagaggaccaagtgcctttataccagagaatgaagttatgcaagcaaacggt
ttggatgaacgtactaatcttcttgtggaagaatattctacgtctggtcgcctggacaac
atcacacaggtcatgagtatccacactcagtacctggagtctttcctccgcagccagttc
tatatgctgcgcatggatgggccccttcctttgccctacaggcactacattgctataatg
gctgctgccagacatcagtgttcctacctaattaatatgcacgttgatgagtttctgaag
actggtgggattgcagagtggttgaacggcttggaatacattccccaaagactgaaaaat
ctgaatgaaataaacaaactccttgcacaccggccctggctaatcacaaaagagcacatt
cagaaacttgtcaagactggggaaaataattggtctcttcctgaactggtgcatgctgtt
gtcctgttggcacattatcatgccttggcaagttttgtatttggtagtggcattaatcca
gagagagatccggaaacatctaatggagtcagacttatagcagtcaacaacttctgtgtc
tgtgatcttgccaatgacaacaacatagaaaatgcatccctcacaagtagcaactttggg
aatgtcatggtgtttttgcagattgcagattctttaagtgagctggaggccttgatggaa
aggatgaagagactacaagaagataaagaggacgaagaagcctctcaggaagaaatggca
actcgctttgaaaaggagaagaaggagagtctgctagttattagtggagcatttgacgat
gaaatagtttctacagatgtctcccgttatattgaagatcctgggtttgggtacaaagac
tttgcaaggcgaggagaagaccatctgccaacattcagagctcaggactatacttgggag
aatcatggcttttcccttgtaaacaggctttattctgatattgggcatcttctggacgag
aagtttcgaatggtatataacctcacatataacactatggcaacgcatgaagatgttgat
acaacgacgctaagaagagctttatttaactatgtccactgtatgtatggaatcaggtat
gatgactatgattatggggaagttaatcagctacttgaacgcagcctgaaggtttacata
aagacagtgacctgctacccagagagaactaccaagcgcatgtacgatagttactggcgt
cagttcaagcactcggagaaggttcatgtcaatctacttctaatggaagctcggatgcaa
gccgaacttctgtatgcccttcgtgccataactcgtcacttaacctga

KEGG   Empidonax traillii (willow flycatcher): 114063386
Entry
114063386         CDS       T05887                                 

Gene name
SESN1
Definition
(RefSeq) sestrin-1 isoform X1
  KO
K10141  sestrin 1/3
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114063386 (SESN1)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 114063386
NCBI-ProteinID: XP_027751423
LinkDB
Position
Unknown
AA seq 546 aa
MEERDGEVRWDGLCSRDAAARAAALDTIGQAVLRRAESIAPAAAADGLPAPAARDGLGEA
LARLLMLSKRCPFPDVREKSEAILGGVQELGIRIPRPLGHGPSRFIPEKETIQVGNEDAT
MHTLFADSFATLGRLDNVTLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAA
RHQCSYLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKMLAHRPWLITKEHIEQL
LKTEENSWSLAELIHAVVLLTHYHSLASFTFGCGISPEIDCEGGHTFRPPSVSNYCICDI
TNGYHGVEEIHASPTGNNPPTESVCEVEALMEKMKQLQECRDEEEASQEEMATRFEREKR
ESMFVCSSEDEESAATRDVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYSWEDHGYSLVNR
LYPDVGQLLDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEIN
QLLDRSFKVYIKTVVCTPEKTTKRMYDSFWRQFEHSEKVHVNLLLVEARMQAELLYALRA
ITRYMT
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggaggagcgggacggcgaggtgcgctgggacgggctgtgcagccgcgacgccgccgcc
cgcgccgccgccctggacaccatcgggcaagccgtgctgcgccgcgccgagagcatcgcc
cccgccgcggccgccgacgggctcccggcgcccgccgcccgcgacgggctgggcgaggcg
ctggcccgcctgctcatgctctccaagcgctgccccttccccgacgtgagggagaagagc
gaggcgatcctcggcggggtgcaggaacttggaataagaattcctagaccactgggacac
ggaccaagcagattcatccctgagaaggagacaattcaagtgggaaacgaagacgccacg
atgcacacgctgtttgcagattcttttgccacgctgggccgactggacaacgttaccttg
gtgatggttttccacccgcagtatcttgaaagctttctaaaaactcagcactatctgctg
caaatggacggtcccctcccgcttcattaccgacactacatcgggataatggctgcagca
cgacatcagtgctcttaccttgttaatctccatgtgaatgacttccttcatgtcggtgga
gaccccaaatggttgaatggtctggaaaatgcacctcaaaaactgcaaaatttaggagaa
ctgaacaaaatgttggctcaccgaccctggcttatcaccaaggaacatattgagcaactt
ttgaagactgaagagaacagctggtccctggcagagctgatccatgcggtcgttctcctt
acgcactaccactccctggcttccttcacatttggttgtgggatcagcccagagattgac
tgtgaagggggtcacaccttcaggcccccttccgtcagtaactactgcatatgtgatatt
actaatggttaccacggggtggaggaaatccatgccagcccaactggaaataatccacct
acagagtcggtctgtgaagttgaagctcttatggagaagatgaagcagctgcaggagtgc
agagatgaagaggaggccagccaggaagagatggctacacgttttgaaagagagaagaga
gaaagcatgttcgtgtgttcttcagaagacgaagaatctgcagcaacaagagatgtgtct
cgtcactttgaggataccagctatggttacaaagacttctccagacacggaatgcatgtg
cccacctttcgtgttcaggattattcctgggaagaccatggctattccttggttaatcgt
ctttatccagatgtgggacagctacttgatgagaagtttcatatcgcttataatctgact
tacaacacaatggccatgcacaaagatgtggatacctcaatgctaagacgagctatttgg
aactatattcattgtatgtttggaataagatacgatgattatgactatggtgaaattaat
cagttgttggaccgcagctttaaagtttacatcaagactgtggtttgcactcctgaaaag
accacaaaaagaatgtatgatagcttctggaggcagtttgaacactctgagaaggtccat
gtaaatttgcttctggtagaagctcggatgcaagccgaactactttatgctctgagagct
attactcgctatatgacctga

KEGG   Empidonax traillii (willow flycatcher): 114067448
Entry
114067448         CDS       T05887                                 

Definition
(RefSeq) sestrin-3-like isoform X1
  KO
K10141  sestrin 1/3
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114067448
SSDB
Motif
Pfam: PA26 CMD Leptin
Other DBs
NCBI-GeneID: 114067448
NCBI-ProteinID: XP_027758702
LinkDB
Position
Unknown
AA seq 454 aa
MIVCPQSVEHPRGSRCQRLPGQVVKMSGSDPECPQFLFVKVLASRGRLEAVTQQMGYHPQ
YLDSFLKMQHYLMHMDGPLPFDCRHYIAIMAAARHQCRYLVNLHVLQFLRAGGDPQWLRG
LEFIPPKLRNLNEINKILAHRPWLITKEHIEKLLKISEWSWSLAELVHAVVLLAHCHALA
SFVFGCGCEQDEGLGGRGSLKGLSLGNQCFCEATAGNSCSQELLRINRKRSLDSCMELDS
LRERMQRIHVETEGREEMRLLQQEREEGLSFLADPDGEVTGATNLACYMQDPDFGYQDFA
RRDEDQTQVFRVQDYSWEDHGFSLVNRLYSDIGHLLDEKFRMVDGLQSSAMAKRQGCEPS
VFKRGIWNYIHCMFGIRYDDYDYAEVNQLLERMLKVYIKTVTCYPEKTNSEMFDRFWKQF
KHSEKVHVNLLILEARMQAELLYALQAITQYMIS
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgatcgtgtgtccccagagcgtggagcacccccgaggaagccgatgccagcggctgccg
gggcaggtagtgaagatgtccggcagcgaccctgagtgcccccagttcctcttcgtgaag
gtgctggcgagccgggggcggctggaggcggtgacccagcagatgggctaccacccccag
tacctggacagcttcctcaagatgcagcactacctgatgcacatggatggccccctgccc
tttgactgccggcactacatcgccatcatggcggctgcccggcaccagtgccggtacctg
gtgaacctgcacgtgctgcagttcctgcgggcagggggtgacccccagtggctgcgcggc
ctcgaattcatcccccccaaactccgcaacctcaacgagatcaacaagatcctggcacac
cggccctggctcatcaccaaggagcacattgagaagctgctgaagatcagcgagtggagc
tggtcgctggcggagctggtgcacgcagtcgtcctcctggcacactgccacgcgctcgcc
agctttgtcttcggctgtggctgcgagcaggacgaggggctggggggccgaggctccctg
aagggcctgtccctcgggaaccagtgcttctgcgaagccaccgccggcaacagctgcagc
caggagctgctgcgcatcaaccgcaagcggtccctggactcctgcatggagctggattcc
ctccgggagcgcatgcagcggatccacgtggagaccgagggcagggaggagatgaggctg
ctgcagcaggagcgagaggaagggctctcctttcttgcagatcctgatggagaagtcacc
ggtgccaccaacctcgcatgctacatgcaggaccctgactttgggtaccaggactttgcc
cggcgcgatgaggatcagacgcaggtattcagagtccaggattattcctgggaagaccat
ggcttctcactggtcaaccggctctactccgacatcgggcatctcctggatgagaagttc
aggatggtggatggtctgcagagcagtgccatggccaagcggcagggctgtgagccctct
gtcttcaagcggggcatctggaactacatccactgcatgtttggcattaggtacgatgat
tatgactatgcagaagtgaatcagctcctggagcgaatgctcaaagtttacattaaaact
gtaacctgctacccagagaagacaaactcagaaatgtttgacaggttctggaagcagttc
aagcacagtgaaaaggtccacgtgaacctgctcatcctggaggcccggatgcaggcagag
ctgctgtatgcactgcaggccatcacccagtacatgatctcctag

KEGG   Empidonax traillii (willow flycatcher): 114068397
Entry
114068397         CDS       T05887                                 

Gene name
SESN2
Definition
(RefSeq) sestrin-2
  KO
K20394  sestrin 2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    114068397 (SESN2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114068397 (SESN2)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 114068397
NCBI-ProteinID: XP_027760228
LinkDB
Position
Unknown
AA seq 471 aa
MLVAGSPCPLEEHRVRGTRRGGQETGIKVPRELAKGPSAFIPLAEIPWEGAESSLRQLLI
EAFVSAGRVDHVAMVMGLHPQYLSSFWKTQYLLLRMDGPLPYHKRHYIAIMAAARHQCSY
LVGLHMGEFLQVGGNPAWLQGLHCAPQKLRNLNEINKLLAHRPWLVTKEHIEALLKPGED
SWSLAELVQALVLLTHYHSLASFVFGCGIKPEEEQDGGNGCWAPSPHSDSSPASEDSMGG
SGGKDAMQEVEMLMERMKLLQENQLEEEGVTQEEMETRFELEKTESLLVPPSDILDPSLQ
SHVRCFVEDPEFGYKDFTRRGEQAPPTFHAQDYTWEDHGFSLINRLYPDVGQLLDEKFQV
VYNLTYNTIAMHCGVDTSMLRRAIWNYVHCVFGIRYDDYDYGEVNQLLERNLKIYIKTVA
CYPEKTTKQIYTQFWRHFKHSEKVHINLLLLEARMQAALLYALRAVTRYMT
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgctcgtggccggctctccgtgtcccctggaggagcatcgggtccgcgggaccaggcgg
ggcgggcaggagacagggatcaaggtcccccgggagctggcgaagggacccagcgccttc
atccccctggcagagatcccgtgggaaggagcggagagcagcctgcgccagctcctcatc
gaggccttcgtgtcggcggggagggtggaccacgtggccatggtcatggggctgcacccc
cagtacctcagcagcttctggaagacccagtacctcctgctgcgcatggacgggcccctg
ccctaccacaagcgccactacatcgccatcatggcagcagcccggcaccagtgctcctac
ctggtgggactgcacatgggggagttcctgcaggtggggggcaaccctgcctggctgcag
ggcctgcactgtgccccccaaaagctccgcaacctcaacgagatcaacaagctgctggcg
caccggccctggctcgtcaccaaggaacacatcgaggctctgctgaagccgggggaggac
agctggtcgctggcagagctggtgcaggccctggtgctcctcacccactaccactcgctc
gcctccttcgtcttcggctgcggcatcaaacccgaggaggagcaggatggggggaacggc
tgctgggccccctccccccacagtgacagcagccctgcctctgaggacagcatggggggc
tctgggggcaaggacgccatgcaggaggtggagatgctgatggagaggatgaagctgctg
caggaaaaccagctggaggaggagggcgtcacacaggaggagatggagacgcgcttcgag
ctggaaaagacggagagtttgctggtccctccctcagatattttggacccctccctgcag
tcccacgtccgctgcttcgtggaggaccccgagttcggctacaaggacttcacacggagg
ggggagcaggcaccccccaccttccatgcccaggattacacgtgggaggaccacggcttc
tcgctgatcaaccgcctgtacccggacgtggggcagctgctggacgagaagttccaggtg
gtttataacctgacctacaacaccatcgccatgcactgcggggtggacacctccatgctc
cgcagggccatctggaactacgtccactgcgtcttcggcatccgctacgacgactacgac
tatggggaggtgaaccagctcctggagcgcaacctgaagatctacatcaagacagtggcc
tgttacccggagaagacgaccaagcagatctacacccagttctggaggcacttcaagcat
tcagagaaggtgcacatcaacctgctcctgctagaggctcggatgcaggcggctctgctc
tacgccctccgcgccgtcacccgctacatgacctga

DBGET integrated database retrieval system