KEGG   Empidonax traillii (willow flycatcher): 114057315
Entry
114057315         CDS       T05887                                 

Gene name
RRM2B
Definition
(RefSeq) LOW QUALITY PROTEIN: ribonucleoside-diphosphate reductase subunit M2 B
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00230  Purine metabolism
etl00240  Pyrimidine metabolism
etl00480  Glutathione metabolism
etl00983  Drug metabolism - other enzymes
etl01100  Metabolic pathways
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114057315 (RRM2B)
   00240 Pyrimidine metabolism
    114057315 (RRM2B)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114057315 (RRM2B)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    114057315 (RRM2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114057315 (RRM2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:etl03400]
    114057315 (RRM2B)
Enzymes [BR:etl01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     114057315 (RRM2B)
DNA repair and recombination proteins [BR:etl03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    114057315 (RRM2B)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 114057315
NCBI-ProteinID: XP_027739199
LinkDB
Position
Unknown
AA seq 445 aa
MGRAELSEIQQRHMQVLHLGRNNPLHQYRLGPLWRQSGGPGGRQAAVHEPAVAGLTRXFA
AFPFLRMMIGAEADGDAGCMAGPEKEIQKVLHSHGLQQRIGKMMLGNLSPSSLSSAAENG
SDLDEEPLLRKNHRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEK
YFISHVLAFFAASDGIVNENLVARFSQEVQIPEARCFYGFQILIENVHSEMYSLLIDTYI
KDPKKRDFLFNAIETMPCIKKKADWALKWIEDRESTFGERVVAFAAVEGIFFSGSFAAIF
WLKKRGLMPGLTFSNELISRDEGLHCDFACLMFHYLVNRPSEERVREIIVNAVEIEQEFL
TEALPVGLIGMNCTLMKKYIEFVADRLLMELGFSKVFHAENPFDFMENISLEGKTNFFEK
RVSEYQRFAVMAETMDNVFTLDADF
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgggcagagcggaactgtctgaaattcaacaaaggcacatgcaggtcctgcacctgggg
aggaataacccccttcaccagtacaggctgggaccactgtggaggcagtctgggggtcct
ggtggacgacaagctgctgtccatgagccagcagtggctgggctaacaagancttttgca
gcatttccatttttaaggatgatgattggtgcagaagcagatggagatgctggctgcatg
gcaggccctgagaaggaaatacaaaaggtcttgcattctcatggtcttcagcagagaatt
ggcaagatgatgctgggaaatttgtctcctagctccctgtcaagtgctgctgagaatggc
tcggaccttgatgaggagcctcttctcagaaaaaatcaccgccgctttgtcatcttcccc
atccagtacccagacatatggaagatgtataagcaggctcaggcctcattttggacagca
gaagaggttgatttgtcaaaggaccttcctcactggaacaaactcaaagcagatgaaaaa
tactttatctctcatgttctggcattttttgcagccagtgatggaattgtaaatgaaaac
ctggtggcacgtttcagtcaggaggtgcagatcccagaagctcgttgtttctatggcttt
cagattctcattgagaatgttcactcagagatgtacagcttgctcatagacacctacatc
aaagatcccaagaaaagggatttcttatttaatgctattgaaacaatgccctgtatcaag
aagaaagcagactgggctctgaagtggattgaagaccgagaatccacttttggtgagaga
gtggttgcctttgctgcagtggaaggcattttcttttcgggttcctttgctgctatattt
tggctgaagaagaggggcctaatgcctggactgactttctccaatgaacttattagcaga
gatgagggtctacactgtgattttgcttgtctaatgttccattatttagtgaacagaccg
tcagaagagcgagtccgtgagatcattgttaatgctgttgaaattgagcaggagtttctg
acagaggcgttacctgtaggtctgattggaatgaattgcaccttgatgaagaaatatatt
gaatttgttgcagaccggttactaatggagctcgggttctcaaaggtctttcatgcagag
aatccttttgatttcatggagaatatttctctggaaggaaaaacaaatttctttgagaag
cgggtttcggaatatcaacgttttgctgttatggcagaaacaatggacaatgtcttcact
ctggatgcagatttttga

KEGG   Empidonax traillii (willow flycatcher): 114058978
Entry
114058978         CDS       T05887                                 

Gene name
RRM2
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00230  Purine metabolism
etl00240  Pyrimidine metabolism
etl00480  Glutathione metabolism
etl00983  Drug metabolism - other enzymes
etl01100  Metabolic pathways
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114058978 (RRM2)
   00240 Pyrimidine metabolism
    114058978 (RRM2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114058978 (RRM2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    114058978 (RRM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114058978 (RRM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:etl03400]
    114058978 (RRM2)
Enzymes [BR:etl01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     114058978 (RRM2)
DNA repair and recombination proteins [BR:etl03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    114058978 (RRM2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 114058978
NCBI-ProteinID: XP_027742709
LinkDB
Position
Unknown
AA seq 398 aa
MLSARAPLAARHDQPQPRLSPKKGHSPTKSLSPMKGLALSDKENTPPALSSARVLASKTA
RKIFQENDGNPVPRGAEEEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSK
DIQHWESLKPEEKYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENI
HSEMYSLLIDTYIKDSREREFLFNAIETLPCVKKKADWAMCWIGDKKATYGERVVAFAAV
EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLIHKPSEERVRE
IIMNAVLIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIYKAENPFDFME
NISLEGKTNFFEKRVGEYQRMGVMSKPTDNSFTLDAEF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgctgtctgcccgcgccccgctcgccgcccgccacgaccagccccagccccggctgtcg
cccaagaagggccactctcctacgaagagcctgtcgcccatgaagggcctggcgctgagc
gacaaggagaacacgccccccgcgctcagcagcgcccgcgtcctggccagcaagacggcc
cgcaagatcttccaggagaacgacgggaacccggtgccgcggggcgcggaggaggagccg
ctgctgcgggagaacccccgccggttcgtcatcttccccatccagtaccacgacatctgg
cagatgtacaagaaggccgaggcctccttctggacggcggaggaggtggacctttccaaa
gacatccagcactgggagtccctgaagcctgaggagaagtacttcatttctcacgtcctc
gccttctttgctgccagcgatggcattgtcaatgagaacttggtggagcggttcagtcaa
gaagtacaaatcacagaagctcgttgtttctatggattccagattgccatggaaaatata
cattcagaaatgtacagtcttcttattgacacctacattaaggattctagagagagggaa
tttctttttaatgctattgaaacgttaccatgcgtcaaaaagaaggctgactgggccatg
tgctggattggggacaagaaagcaacatatggagaacgtgtagtagcctttgcagctgtg
gaaggaatcttcttttctgggtcatttgcatcaattttttggctgaagaaaagaggatta
atgcctggactcactttttctaatgaactcatcagtagagatgagggtttgcactgtgat
tttgcctgcctcatgttcaagcacctgatacacaaaccatcagaggagagagtaagggaa
atcatcatgaatgctgttctcatagagcaggagttcttgacagaggcactgcctgtgaag
ctgatcggcatgaactgcactttaatgaaacagtacatagagtttgtggcagaccggctg
atgttggagctgggatttaacaagatatacaaagcagagaatccttttgacttcatggaa
aacatctctttggaaggcaagaccaatttctttgagaagcgagtaggtgaatatcagagg
atgggagtcatgtcgaagcccacagacaactctttcaccctggatgcagaattttaa

DBGET integrated database retrieval system