KEGG   Empidonax traillii (willow flycatcher): 114057681
Entry
114057681         CDS       T05887                                 

Gene name
SPOPL
Definition
(RefSeq) speckle-type POZ protein-like isoform X1
  KO
K10523  speckle-type POZ protein
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114057681 (SPOPL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:etl04121]
    114057681 (SPOPL)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     114057681 (SPOPL)
SSDB
Motif
Pfam: BTB MATH
Other DBs
NCBI-GeneID: 114057681
NCBI-ProteinID: XP_027740074
LinkDB
Position
Unknown
AA seq 392 aa
MSRVPTPPPPGEMSSGPVAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PNDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQSNTNTLK
VPECRLAEDLGNLWETTRFTDCSFYVGGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNR
VEINDVDPEVFKEMMRFIYTGKAPNLEKMADNLLAAADKYALERLKVMCEEALCSNLSVE
NVADILILADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETAGWKSMI
HSHPHLVAEAFRALASAQCPQFGIPRKRLKQS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtcaagggttcccaccccacctcctcctggggagatgtccagtggacctgtggctgaa
agctggtgttacacacaggttaaagtagtaaaattttcctatatgtggaccattaataac
ttcagtttttgccgagaagaaatgggtgaagttctaaagagttctaccttttcatcaggg
ccaaatgacaaaatgaagtggtgcctgagagtgaatccaaagggattagatgatgaaagc
aaagactatctgtcactgtatttgcttctagtcagttgtccaaaaagtgaagtcagagca
aaattcaaattttccctgctgaatgcgaaaagagaagaaacaaaagcaatggaaagccaa
agagcctatcgatttgtgcaaggcaaggactgggggtttaagaaatttatccgaagagat
tttttgctagatgaagctaatggtcttctaccagatgacaagcttacgttattttgtgag
gtaagcgtggtccaagactcagtaaatatatcaggacagtctaatacaaacactttgaag
gtacctgaatgtcgactagcagaagatttagggaatctctgggaaaccacaagatttaca
gattgcagtttttatgtaggaggacaagaattcaaagctcataaatctgtccttgcagca
cggtctccagtttttaatgcaatgtttgaacatgaaatggaggaaagcaaaaagaatcgt
gtagaaataaatgatgtagaccctgaagtttttaaagaaatgatgagatttatttacaca
ggaaaagcaccaaaccttgaaaaaatggctgacaatttgttggcagctgcagacaaatat
gcactggaaaggctgaaggtgatgtgtgaggaagcactctgcagtaacctctcggtagaa
aatgttgcagacattcttatcctcgcagatttgcacagcgctgaacagttaaaagcacaa
gcaatagactttattaacaggtgcagtgttcttagacaacttgggtgtaaagatgggaaa
aactggaatagcaaccaagcaacagacataatggaaacagcaggctggaagtccatgatc
cactcccaccctcacttagtagcagaggcctttcgcgcactggcgtctgcacagtgtcca
cagtttggcattccacgcaaacggctaaaacagtcatga

KEGG   Empidonax traillii (willow flycatcher): 114071494
Entry
114071494         CDS       T05887                                 

Gene name
SPOP
Definition
(RefSeq) speckle-type POZ protein
  KO
K10523  speckle-type POZ protein
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114071494 (SPOP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:etl04121]
    114071494 (SPOP)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     114071494 (SPOP)
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 114071494
NCBI-ProteinID: XP_027765124
LinkDB
Position
Unknown
AA seq 374 aa
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPECRLADELGGLWENSRFTDCCLCVAGQEFKGHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVE
NAAEILILADLHSADQLKTQAVDFINYHASDVMETSGWKSMVVSHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcaagggtgccgagtccgcctcctccggcagagatgtcgagtgggcctgtggcagag
agctggtgctacacccagatcaaggtggtgaagttctcctacatgtggaccatcaacaac
ttcagcttctgccgggaggagatgggggaggtcatcaagagctcgaccttctcatctgga
gccaacgataagctcaaatggtgtttgcgagtgaaccccaaaggcctggatgaggagagc
aaggattacctgtccctgtacctgctgctggtgagctgccccaaaagcgaagtgcgagcc
aagttcaagttctccatcctcaacgcgaagggagaggagaccaaagcgatggagagccag
cgagcctatcggttcgtgcagggcaaggactggggcttcaagaaattcattcggagagac
ttccttctggatgaagccaatggactcctcccagatgacaaactcactctcttctgtgag
gtgagtgtggtgcaggactctgtgaacatctctggccagaacaccatgaacatggtgaag
gtccccgagtgccgcttggccgacgagctgggggggctctgggagaactcgcggttcacg
gattgctgcctctgcgtggcaggccaggagttcaaggggcacaaagccatcctggcagca
cgttccccagtgttcagcgccatgtttgagcacgagatggaagagagtaaaaagaatcgg
gttgaaatcaatgatgtggagccggaagtttttaaggaaatgatgtgttttatttatact
gggaaggcaccaaatcttgacaaaatggctgatgacttgctggcagctgctgacaagtac
gccctggagcggctcaaggtgatgtgtgaggacgccctgtgcagtaacctgtccgtggag
aacgcggccgagatcctcatcctggctgacctgcacagcgctgaccagctcaaaacccag
gctgtggacttcatcaactaccacgcctctgatgtcatggagacgtcgggctggaagtcc
atggtggtgtcccacccccacctggtggccgaggcctatcgctccttggcgtccgcacag
tgtcccttcctggggccgccccggaagcgactgaagcaatcctaa

DBGET integrated database retrieval system