KEGG   Empidonax traillii (willow flycatcher): 114058007
Entry
114058007         CDS       T05887                                 

Gene name
KIF7
Definition
(RefSeq) kinesin-like protein KIF7 isoform X1
  KO
K18806  kinesin family member 7
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114058007 (KIF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:etl04812]
    114058007 (KIF7)
Cytoskeleton proteins [BR:etl04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     114058007 (KIF7)
SSDB
Motif
Pfam: Kinesin Microtub_bd PepSY_TM_like_2
Other DBs
NCBI-GeneID: 114058007
NCBI-ProteinID: XP_027740737
LinkDB
Position
Unknown
AA seq 1379 aa
MAAEGAAVRVAVRVRPLLPREALRGHRPCLRGDAATGEVSLGRRRFRFAAVLPEAAGQAA
VYRACVQPLLRAFFRGFNATVFAYGQTGSGKTYTIGEASVASINEDEQGIIPRAMAETFR
LIDENDLIDYTVRVSYLEVYKEEFRDLLQVDTASKDIQIREDDKGNIVLCGVKESEVEGL
DEVLSLLEMGNTAKHTGATHINRQSSRSHTIFTVTMEQRRGAGRLPLHHRPPSVPAAGQV
LVSKFHFVDLAGSERIVKTGNTGERLKESIQINCGLLALGNVISALGDPRRKTTHIPYRD
SKITRILKDSLGGNAQTVMIACVSPSSSDFDESLNTLNYANRAQNIQNKAVVNCRKETEQ
IEELHLQIKNLQKALEQRQRSETRIINRSGSAKRCAPDPTARLLAECAHYRTCTDAAYRL
LMELQEDSNLTVEQILRVKEWLCTVESERSELTSAGLDSGIESTSMEDQSAEAQSSKLAK
AQVNTEKKCESIKDEQVAKLQRQVERLEEENRDFLAALEDAMEQYKLQSDKLQEQQDKIS
ELHVRLEMAMPNLCVPGLLENLPLVTSSQRPHTAPLDAAPSHSLGGVLSGLPPEQCGRAL
CRKQLNNNFSFQEEEPAGWHLNHTQCLTGDPEVKDVVLRREFSQDSEKPSELSLGEEVEE
WERKRSLSQRRNGIQNWSKKEICMLSEEPSRGSAHSIQEEQLELSKEVCGKREPLLSSWE
RLPGKDSEWRLVQAQQKIRELAINIRMKEELITELIKTGKDAQALNRQYSQKISELEQEA
EQVRAELSDSQKQLQELEGKEPWDPGEKRKLQEYRTRVAAAQSKAQVLCKKKQATERLVS
LSAQSEKRVQELERNIQLMRRQQGQLQRRLREESEQKRRLETEVNKGQHRVKELELKHEQ
HQKILRIKTEEIAAFQRKRRSGSNGSVISLEQQQKIEEQKKWLDMEMDKVLEQRRALDEL
EDELRKREAIVAKKEALLQEKNGLESKRLRSSQALTDDIVRVSSRLEHLEKELTEKNGQL
RHGSAHDQQQIRQEINSLRQEKDQLLKQRLELDNKLRQGTLLSPEEERILFQLDEAIEAL
DAAIEYKNESITCRQRVLRASASLLSQCEMNLMAKLSYLSSSETRALLCKYFDKVVTLRE
DQHRQHIAFSELEMQLEEQQQLVYWLEAAVERQRLEMDRQLTLQQKEHEQNMQLLLQQSR
EHMDEGLASSKLQYEARIQLLEKELSRYMWANQELNQRLSNMNLHPGQTKAGMERSIHGA
GDRAAPALGTCEESSPGEQPVPLAVAEESHRGREDNRDLVHAPLPSTWRRSSLPNDSPGD
LRQRDVEHLLRAGQPHELHPPPRSLAPASKPRRELRRASLNISPLPHHPAMIDVRKNPL
NT seq 4140 nt   +upstreamnt  +downstreamnt
atggcggcggagggggctgcggtgcgggtggcggtgcgggtgcggccgctgctgccccgg
gaggcgctgcgggggcaccgaccctgcctgcggggcgatgccgccaccggcgaggtgtcg
ctgggccgccgccggttccgcttcgccgccgtgctgcccgaggcggcggggcaggcggcc
gtgtaccgggcctgcgtccagccgctgctgcgcgccttcttccgcggcttcaacgccacc
gtcttcgcctacgggcagacgggctccggcaagacctacaccatcggggaggccagcgtc
gcttccatcaatgaagacgagcagggcatcatcccacgagccatggccgagaccttcagg
ctcatcgatgagaatgacctgatcgactatacggtacgagtgtcctacctggaagtgtac
aaggaggagtttcgggacttgctgcaggtggatacagccagcaaagacatccagatccgg
gaggatgacaaggggaacattgtgctctgcggtgtgaaggagtcagaagtggaagggctg
gacgaggtgctgagcctgctggagatggggaacacagccaagcacacgggagccacccac
atcaacaggcagtcgagccgctcgcacaccatcttcacggtgaccatggagcagcggcgt
ggggctggacgcctgcccctgcaccaccgcccgccctccgtccccgccgcgggacaggtc
ctggtctccaagtttcactttgtggacctggcaggctcagagcgaattgtgaagacagga
aacacaggggagaggctgaaggagagtatccagatcaactgtggcctcctggccttgggc
aacgtcatcagtgccttgggagatcctcggagaaagaccacccacatcccatacagggac
tccaaaatcaccaggatcttgaaagactctctgggggggaacgcccagactgtgatgata
gcctgtgtcagcccatcctcctccgatttcgacgagagcctcaacacactgaattacgcc
aaccgggctcagaacatccagaacaaggcggtggtgaactgccgcaaggagacagagcag
attgaggagcttcacctgcagataaagaacctgcagaaggcgctggagcagcgtcagcgc
tccgagacccgcatcatcaaccgctcgggcagcgccaagcgctgcgcgcccgaccccacg
gcacggctgctggcggagtgcgcccattaccgcacctgcaccgacgccgcataccggctg
ctgatggagctccaggaggacagtaacctgacagtggagcagatcctgcgggtcaaggag
tggctgtgcaccgtggagagcgagaggagcgagctgacctcggccgggctggacagcggc
attgagagcacctccatggaggaccaaagcgccgaggcacaaagctcaaagctggcaaag
gcccaggtgaacaccgagaagaaatgtgagtccatcaaagatgagcaggtggccaaactg
cagaggcaggtagagcgcctagaggaggagaaccgtgatttcctggctgccctggaggat
gccatggagcagtataagctgcagagtgacaaactgcaggagcagcaggataagatctca
gagctgcatgtgcgcttggagatggcaatgccaaacctatgtgtgccaggactgctggaa
aaccttcccctggtgacctccagccagagacctcacacggccccactggatgctgccccg
tcccacagccttggtggagttctctcagggctccctcctgagcagtgtggaagagccctc
tgcaggaagcagctcaacaacaacttctccttccaggaggaggagccagcaggctggcac
ctgaaccacacacagtgcctgactggtgatcctgaggtcaaagatgtggtgctgaggagg
gagttcagccaggactcagagaagccatcagagctgtccttgggagaggaggtggaggag
tgggaacggaagcggtccctatcccagcgccgaaatgggatccaaaactggagcaagaaa
gagatttgcatgttgagtgaggagccaagtagaggcagtgcccactctattcaggaggag
cagctggagctgtcaaaagaggtctgtgggaagcgggagccgctgctcagttcctgggag
cgcctaccaggaaaggactctgagtggaggctggtgcaagcacagcagaagatccgagag
ctggcgatcaacatccgcatgaaggaggaactgatcacagagctcattaagacaggcaag
gacgcgcaggctctgaacaggcagtacagccagaagatcagcgagctggagcaggaagca
gagcaggtgcgggcagagctgagcgatagccagaagcagctccaggagctggagggcaag
gagccgtgggaccccggagagaagcgcaagctgcaggaataccgcacacgtgtggcggcc
gcgcagagcaaggcacaggttctgtgcaagaagaagcaggcaacagagaggctggtgtca
ctctcggcccagagcgagaagcgggtgcaggagctggagaggaacatccagctgatgcgg
cggcagcaggggcagctgcagcggcggctgcgggaggagagtgagcagaaacggcggctg
gagacggaggtgaacaagggacagcaccgagtcaaggaactggaactgaagcacgagcag
caccagaaaatcctgcgcatcaaaacagaggaaattgcggctttccagaggaagcggcgg
agtggcagcaacggttccgtgatcagcctggagcagcagcagaaaattgaggaacagaag
aagtggctggacatggagatggataaagttctggagcagcgccgagccctggatgagctg
gaagatgagctgaggaagcgggaagctatcgtggccaaaaaggaagccctgctgcaggaa
aagaatggcttggagagcaaacgactgcgctccagccaggccctcacagatgacatagtg
cgtgtgtccagccgcctggagcacctggagaaggaactgactgagaagaacgggcagctg
cgccacggcagtgcccatgaccaacagcagatccgccaggagatcaacagcctgcgccag
gagaaggaccaactgctcaaacagaggctggagcttgacaacaagctgcgtcagggcacc
ttgctgtccccagaggaggaacggatcttattccagctggatgaggcaatcgaggctctg
gatgcagccatcgagtacaagaacgaatccatcacgtgcaggcaacgagtcctgcgggcc
tcggccagcctgctgtcccagtgtgagatgaacctcatggccaagctcagctacctgtcc
tcctctgagacccgagctctgctctgcaagtactttgacaaggtggtgaccctgcgagag
gatcagcacaggcagcacattgccttctcggagctggagatgcagctggaggagcagcag
cagctggtgtactggctggaggcggccgtggagcgccagcgcctggagatggaccggcag
ctcaccctgcagcagaaggagcacgagcagaacatgcagttactgctgcagcagagccgt
gagcacatggacgaggggctggccagcagcaagctgcagtatgaggcaaggattcagctg
ctggaaaaggagctgagccgttacatgtgggcaaaccaggagctgaaccagagactgagt
aacatgaacctccatcctggacagaccaaagcaggaatggagagaagcattcacggggct
ggggacagagctgcccctgcactcgggacctgtgaggaatccagccctggggagcagccc
gtgcctctggctgtcgctgaagagagccatcggggcagggaggacaatagggacctggtg
cacgcccctctgccttccacgtggagacgttcctccctgcccaacgacagccccggggac
ctccggcagagggacgtggagcacttgctgagggcggggcagccccatgagctgcaccca
cccccccggagcctcgctcctgcttccaagccccgccgggaactgcgcagagccagcctc
aacatcagccccctgcctcaccacccagccatgatcgacgtgaggaaaaaccccctctag

DBGET integrated database retrieval system