KEGG   Empidonax traillii (willow flycatcher): 114058301
Entry
114058301         CDS       T05887                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04020  Calcium signaling pathway
etl04144  Endocytosis
etl04510  Focal adhesion
etl04540  Gap junction
etl04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114058301 (PDGFRA)
   04020 Calcium signaling pathway
    114058301 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114058301 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114058301 (PDGFRA)
   04540 Gap junction
    114058301 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114058301 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114058301 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:etl04090]
    114058301 (PDGFRA)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     114058301 (PDGFRA)
Protein kinases [BR:etl01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   114058301 (PDGFRA)
CD molecules [BR:etl04090]
 Proteins
  114058301 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Herpes_gE Adeno_E3_CR1
Other DBs
NCBI-GeneID: 114058301
NCBI-ProteinID: XP_027741305
LinkDB
Position
Unknown
AA seq 1087 aa
MGTSPWMFLILGCFLTGPFLTFCQLPLPTIVPSRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVVNASAAHTGLYVCYYNHTQVEDGEVEGKNIYIYV
PDPDMPFVPSIPEDQFILVEEGDPTVIPCRTSDPGAQVTLTDSLDKAVEALYDPKQGFIG
NFPAGSYACKTMAKGVEFKSDEFLVYIIRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSVLKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALISAL
VDDHHGTTGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
KNTVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSMSESEVKN
LLSDDGSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacctccccatggatgttcctgattctgggatgttttcttacaggaccgttctta
acattttgccagcttcctctgccgactattgttcccagtaggaatgaaatggttgtacag
ctgaattccaatttcacactcaaatgctctggagacagtgaagtgagctggcagtaccca
gtgactgagggaagtcacaggatagacatcagacatgaagaaaacaacagtggcctcttc
gtgacagtgctcgaagtagtaaatgcctcagctgctcatacaggcttgtatgtttgctat
tataaccacacacaagtggaggatggggaagtggaagggaagaacatctacatctatgtg
cctgacccagacatgccttttgttccttctataccggaagaccagttcatccttgtagaa
gaaggtgatcccacagttatcccttgtcggacaagtgacccaggtgctcaagtgacttta
actgacagcttagacaaggctgtggaagctttatatgaccccaaacaaggcttcatagga
aattttcctgcgggctcatacgcatgcaaaacaatggctaagggcgtggagttcaagtct
gatgagttcctcgtctatattataagagctacttcacagcttccggttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcccgggaaagtgaaggaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcacagaagctggtttacaccctgaccattcctgaggca
tcagtgaaagacacaggggattatgaatgtactgctcggcatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaaggctttgttcacctggagcctcag
tttagccctctggaagctgtcaacctgcacgaagtcaaaaactttgttgttgatgtgcag
gcttacccagcaccaaaaatgtactggttgaaggataatgtgactctgattgaaaatctt
actgagattgttactagttctaacagagtccaggaaacaaggtttcagagtgtattaaaa
ttgatacgggccaaggaagaagacagcggatactatactttggttgctgaaaatgaagac
gagattaaaagatacaccttctccttgctaatacaagttccagctctgatctcagccctt
gtggatgatcatcatggcactacaggtgggcagacagtgagatgcttggcagaggggacc
ccacttcctgatgtggaatggctggtttgcaaggatattaaaaagtgcagcaatgacacc
tcgtggacccttttgactaacaatatctctgatatacacatggaagcccacctggatgag
aaaaatacggtggaaagccaggtgaccttccaaaaggtagaggaaaccctggctgtgcga
tgtgtggcaaggaatgacctcggtgctgttactcgagaactgaagcttgtggctcccacc
ttacgatcagagctaacggtggctgctgctgtcttagtgctgttagtgattgtgataatt
tccctgattgtcctagtcatcatatggaaacagaagccgaggtatgagattagatggaga
gtcattgaatctatcagccctgatggccatgaatacatttatgtggacccaatgcaactg
ccctatgactccagatgggagtttcctcgagatgggttagtgcttggtcgaatccttggt
tctggtgcatttggaaaagtagttgaagggactgcatatggattgagtcgttctcaacca
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggcg
ctcatgtctgaactgaagataatgacacatcttggcccccacctgaatattgtgaatctg
cttggagcttgtacaaaatcaggtcctatttacatcattactgaatactgcttttatggt
gatttggtgaactacctacataagaacagggacaatttcctgaaccgacacccagagaag
ccaaagaaagatttggatatctttgggatgaacccagctgatgaaagcacaagaagttat
gtgatattatcatttgaaaacactggagaatacatggacatgaaacaagctgataccact
cagtatgtgcctatgctggaaaggaaggagggatctaaatactctgatattcagagatct
gtgtatgatcgacctgcttcatacaagaagaaatccatgtcagaatcagaagtcaaaaac
cttctttcggatgatggctcagagggactcagcctactggatttgctgagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtgcaccgtgacttggca
gctcgtaatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttgggctggct
agagacatcatgcatgattccaactatgtctccaagggcagcactttcctcccagtaaaa
tggatggcacctgaaagcatttttgacaacctatacacaacattaagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gtcgattctactttctacaataagatcaagagtggataccgaatggccaaacctgaccat
gctaccaatgaagtgtatgagatcatggtgaagtgctggaacagtgaaccagaaaaaaga
ccttctttctatcatttgagtgaaattgtggagaacttgttgcctggagagtacaaaaag
agctatgagaagattcacctggacttcctgaaaagtgatcacccagctgtcacacgcatg
agaggggactgtgacaatgcttacattggtgtcacctacaagaatgaagacaagctaaag
gacagggagagtggttttgatgagcagaggctgagtgctgacagtggatacatcatcccc
ctgcctgacattgaccccgtttctgaagatgagcttggcaaaagaaacagacacagttca
cagacatctgaagaaagtgccattgaaaccggttccagtagctctaccttcatcaagaga
gaggatgagaccattgaggacattgacatgatggacgacatcgggattgactcctcagac
ctggtggaggacagtttcctgtaa

DBGET integrated database retrieval system