KEGG   Empidonax traillii (willow flycatcher): 114058748
Entry
114058748         CDS       T05887                                 

Gene name
SHISA5
Definition
(RefSeq) protein shisa-5
  KO
K10135  scotin
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114058748 (SHISA5)
SSDB
Motif
Pfam: Shisa FAM163
Other DBs
NCBI-GeneID: 114058748
NCBI-ProteinID: XP_027742204
LinkDB
Position
Unknown
AA seq 138 aa
MGFGTVIAIGVTVCAVIVITIVLCLTCSCCCLYKACRRPRPVVTTTATTTVVHAPYPQQA
AVPPSYPAAPYQGYQPVAIQPQPGMPVAPYPTQYPPPYPTQPSGPPAYHETVAAGAGAPY
PSQPPYNPAYMDPQKPTY
NT seq 417 nt   +upstreamnt  +downstreamnt
atgggttttggaaccgttattgcgattggagttactgtctgtgcagtgattgtcatcact
attgttctgtgcctcacctgctcctgttgctgtctctataaagcatgtcggagaccacgg
cctgttgtgaccaccactgccaccactacagtggtccacgctccttatccccaacaagca
gcagtgccacccagctatccagcagctccatatcaaggataccagcccgtggccatccag
ccccagccgggaatgccggtagcaccgtaccctacacagtaccctcccccttaccccacg
cagccctcgggaccgccggcctatcatgagacggtggcagctggtgctggagccccttac
ccaagccagcccccttacaaccctgcttacatggatcctcagaaacccacctattga

DBGET integrated database retrieval system