KEGG   Empidonax traillii (willow flycatcher): 114058757
Entry
114058757         CDS       T05887                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
etl  Empidonax traillii (willow flycatcher)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 Ras_bdg_2 Mst1_SARAH PHD
Other DBs
NCBI-GeneID: 114058757
NCBI-ProteinID: XP_027742216
LinkDB
Position
Unknown
AA seq 340 aa
MELIELRELQPEPRPGRGRLERTNALRISPARRPGPGAHPDPRLTAVPGGGHRFEPRRRG
LHTWCDLCGDFIWGGGRKSLQCRYCSFTCHYRCRALVRLDCSGPPGTSDEDDGNELEKDT
NVDEPSEWEKTELDQTQVEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVP
ATKKGPALQAGRPHTQGVKRRTSFYLPKGTVKHLHILSHTRASEVIDALLRKFTVVDNPR
KFALFERSEKDEQVYLRKLGDDEQPLRLRLLAGPSEKVLSFVLKENETGEVNWDAFTLPE
LHNFLRILQREEEEHVRRLRHRYARCRQKMQEALATRTPG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggaactcatcgagctgcgggagctgcagccggagccgcggccgggccggggccgccta
gaacggaccaacgcgctgcgcatcagcccggcccgccggcccggccccggagcgcatccc
gacccgcggctgacggccgtcccgggcggcgggcaccgcttcgagccgcggcgccgcggg
ctgcacacctggtgcgatctctgcggggacttcatctggggcggcggcaggaagagcctc
cagtgccgctattgcagcttcacctgccactaccggtgccgggccctcgtgcggctggac
tgcagtggccccccaggcaccagcgatgaggacgatggcaacgagctggagaaggacacc
aatgtggatgagcccagcgagtgggagaagacagagctggaccagacgcaggtggagcag
cggatcaaggagtacaacagccagatcaacagcaacctcttcatgagcctgaacaaggac
ggctcctacaccggcttcatcaaggtgcagctgaagctggtgcgccctgtctcggtgccg
gccaccaagaagggtcccgccctgcaggcggggcggccgcacacccagggcgtgaagcgc
cgcacgtccttctacctgcccaagggcaccgtgaagcacctgcacatcctgtcgcacacc
cgcgccagcgaggtcatcgacgccctcctccgcaagttcaccgtcgtcgacaatccccgc
aagttcgctctcttcgagaggtctgagaaggatgagcaagtgtacctgcggaagctgggt
gacgacgagcagcccctgcggctgcggctgctggctggccccagtgagaaagtgctgagc
ttcgtcctgaaggagaacgagaccggagaggtgaactgggacgccttcacgctgccggag
ctgcacaacttcctgcgcatcctgcagcgggaggaggaggagcacgtgcggcggctgcgg
caccgctacgcccgctgccgccagaagatgcaggaggcgctggccacgcgcacgccgggg
tga

DBGET integrated database retrieval system