KEGG   Empidonax traillii (willow flycatcher): 114058833
Entry
114058833         CDS       T05887                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl03420  Nucleotide excision repair
etl04115  p53 signaling pathway
etl04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114058833 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    114058833 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114058833 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:etl04121]
    114058833 (DDB2)
   03400 DNA repair and recombination proteins [BR:etl03400]
    114058833 (DDB2)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     114058833 (DDB2)
DNA repair and recombination proteins [BR:etl03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      114058833 (DDB2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 114058833
NCBI-ProteinID: XP_027742399
LinkDB
Position
Unknown
AA seq 515 aa
MAPVNQPKDKEYERVYQHWPEEAKSAGKRKPDYEKLGNETQAKKLFVRKTSKPPGKIGWS
GGGSVVGNKSVLSHQLEQQRSIVHYVYQNMLGGSIRAPLRQCLQLPFLRSLASYRLFRTA
SPFDRRVTCLEWHPTHPSTVAVGSKGGDIILWDYEVLTKTCFIKGKGAGDSLGDIKFSPY
EAVKLYVASGDGTLSLQDLESRAVQVISRAPDCGHEHHNVCCWYCSVDVSASSRAVVTGD
NVGNVVLLSTSGEEIWKLKLHKKKVTHVEFNSRCEWLLATASVDQTVKIWDLRNIKNKMS
FLHVLPHEKPVNAAYFSPTDGAKLLSTDQRNEIRVYSSSDWTKPQHLIPHPHRHFQHLTP
IKATWHPRYDLIVVGRYPDPKFPEYTMDELRTVDVFDGNTGEMVCQLHDPNACGIISLNK
FNPMGDTLASGTGFNILIWSREEMVAKKQEHLLKAMTEQGIGSWSSSRRGGQRQANPGTS
KLKAKLLSWELEETRTKNSDSKSKGRKRKGKDLEK
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggctccagtgaaccagccaaaggacaaggagtatgagagggtgtatcagcattggcca
gaggaggcaaaatcggctgggaagaggaaaccggactatgagaaactagggaatgagaca
caagcaaagaagttgttcgtgagaaaaacatctaaacccccagggaaaatcggttggagt
ggaggtgggtctgtggtgggaaacaagagcgtcctttcccatcagctggagcagcagcgc
agcattgttcattatgtctatcagaacatgctgggaggctccattcgggcaccactcagg
cagtgtctgcagctgccttttctgcgttctcttgcctcataccgcctctttcgaacagca
agtccttttgacaggagagtgacatgcttggaatggcatccaacacaccccagtacagta
gctgttggttccaaaggtggagacatcatcctttgggactatgaagtactcactaaaacg
tgcttcataaaggggaaaggggctggagattctcttggagacatcaagttcagtccttat
gaggcagtgaagctttatgtggcatcgggtgatggcaccctaagtctgcaggaccttgag
agcagagcggtgcaggtgatctctcgtgccccggactgtggccacgagcaccataatgtt
tgctgctggtactgcagtgtggatgtttctgcaagcagccgtgcagtggtgacaggtgat
aatgtgggcaacgtggtcctgctcagcacttctggtgaagagatttggaagctgaaattg
cacaagaagaaagtgactcatgtagagttcaactcccgatgtgagtggctgttggccaca
gcatctgtggatcagacagttaaaatctgggacctcagaaacatcaaaaacaaaatgagc
tttcttcatgtgcttcctcatgagaaacctgtcaatgcagcttacttcagcccaacagat
ggtgcaaagcttctgagcacagaccagcgcaatgagatcagggtttactcatcttcagac
tggaccaagccacagcatctgattccacatccacataggcattttcagcacctcacacct
attaaggccacatggcatcctcgctatgacctcattgtcgtaggtcgctacccagacccc
aagttcccagagtacacaatggatgagctacgaactgttgatgtattcgacggaaacacc
ggagagatggtttgccagctccatgatccaaatgcttgtggtatcatctcgctcaataaa
tttaaccctatgggagacacactggcttctggcacgggctttaatattctgatttggagc
cgggaggagatggtggccaagaagcaagaacatcttttgaaagccatgacagaacagggg
attggaagctggagttcatccagacgtggagggcagaggcaggcgaaccctggcacaagc
aaactcaaagctaagttattgtcttgggagctggaggagacaagaacaaaaaacagtgat
tctaaatccaagggaagaaagcgaaaagggaaggatctagagaagtga

DBGET integrated database retrieval system