KEGG   Empidonax traillii (willow flycatcher): 114059390
Entry
114059390         CDS       T05887                                 

Gene name
XPOT
Definition
(RefSeq) exportin-T isoform X1
  KO
K14288  exportin-T
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl03013  RNA transport
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    114059390 (XPOT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:etl03016]
    114059390 (XPOT)
Transfer RNA biogenesis [BR:etl03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    114059390 (XPOT)
SSDB
Motif
Pfam: Xpo1
Other DBs
NCBI-GeneID: 114059390
NCBI-ProteinID: XP_027743554
LinkDB
Position
Unknown
AA seq 962 aa
MDEQALLGLNPNADAEFRQRALAYFEQLKISQDAWQVCAEALAQSIYSDDHIKFFCFQVL
EHQVKFKYSELTEVQQQLIRETLITWLQAQMLNPQPEKTFIRNKAAQVFALLFVTEYLTK
WPKFFFDILSVVDLNPRGVDMYLRILMAVDAELVDRDVVHTSEEARRNTLLKDTMREQCI
PSLVESWYQILQNYQYNNSELTCQCLEVVGAYVSWIDLSLIANERFINMLLGHMSVEVLR
EEACDCLFEIVNKGMDPIDKTKLVESLCQVLQSAGLFSIDQEDDVDFLARFSKLVNGMGQ
ALIASWTKLIKSGDMKSAQDTLQAIEAKVALMLQLLVHEDDDISSNIIGFCYDYLHILKQ
LPALSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLLLDRLAQVSP
ELLLAAVRRVFNTTLQNWQTTRFMEVEVAIRLLYMLAEALPVSHGAHFSGDVTKATALQD
MMRTLVTSGVSAYQHTSVTLEFFETVVRYEKFFAVEPQHIPAVLMAFLDHRGLRHTSPKV
RSRTAYLFSRFVKSLNKQMNPFIEDVLNRIQDLMELSPPENGYQALLSSDDQLFIYETAG
VLIVNSEYSAERKQVLMRNLLTPLMEKFKVLLEKLMMAQDEDRQMALADCLNHAVGFASR
TSKAFSNKQTVKQCGCSEVYLDCLQTFLPALSCPLQKEVLRSGVRTFLHRMIICLEEEVL
PFIPSASEHMLKDCEAKDLQEFIPLINQITAKFKTQVSPFLQQMFMPLLHAIFEVLLLPA
EENDQSAALEKQMLRRSYFAFLQTVTGSGMSEVIANQGAENVERVMFTVIQGAVDYPDPI
AQKTCFIILSKLVELWGGKDGPVGFADFVYKHIVPACFLAPLKQTFDLADAQTVLALSEC
AVTLKTIHLKRGPECIQYLQQEYLPSLQVAPEIIQEFCQALQQPDAKVFKNYLKVFFQRA
KP
NT seq 2889 nt   +upstreamnt  +downstreamnt
atggatgaacaagcccttttagggctaaacccaaatgctgatgcagaattcagacaaaga
gcactagcctactttgagcagcttaagatatctcaggatgcttggcaagtctgtgcagaa
gcgttagctcagagtatatacagtgatgatcatatcaagttcttctgctttcaagtcctg
gaacatcaagttaagttcaaatactctgaacttactgaagtccagcagcagctaattagg
gaaacgctcataacatggctgcaagcacagatgctgaatccccagcctgagaagaccttc
attcgcaacaaagcagcacaagtctttgcattgctttttgttactgaatatctcacaaaa
tggcccaagtttttttttgacattctatcagtagttgaccttaatccacgaggcgtagat
atgtacctcagaatcctgatggctgttgatgctgagctggtggaccgggatgttgttcat
acatcagaggaggctcgtaggaacaccttattaaaagatactatgagggaacagtgcatt
ccaagtttggtggaatcgtggtaccaaatcttacaaaactatcaatataataactcagag
ctgacatgccagtgccttgaagtagttggagcttatgtatcctggatagatttgagcctg
atagccaatgaaaggtttataaatatgctgctaggtcacatgtctgtggaagttctccga
gaagaagcctgtgattgtctgtttgaaattgtaaataagggaatggacccaattgataaa
acaaaattggttgaatctttgtgtcaagtattgcagtctgctggcctcttcagtatcgat
caggaagatgatgtggattttctggccagattttctaagctggtcaatgggatggggcaa
gcattaatagctagttggactaaactgataaaaagtggtgatatgaagagtgctcaagac
actctacaagctattgaagcaaaagtggccctgatgttgcaactgctggttcacgaagat
gatgacatctcctctaacatcattggcttttgttatgattaccttcacatcctgaaacaa
cttcctgcactttcagaccaacaaaaagctaatgtggaggcaatcatgttggctgttatg
aagaagttgacatatgatgaagaatataattttgaaaatgagggtgaagatgaagcaatg
tttgtggagtacagaaaacagttaaaactgttgctggacagacttgctcaggtttcacca
gaattactgttggcagctgtccgcagagtttttaacactacgcttcagaactggcagact
acacgatttatggaagtagaagtagcaataaggctgctgtatatgttggctgaagctctt
cctgtatctcatggtgctcacttctctggtgatgttactaaagccacagctttacaagac
atgatgagaacactggtgacttctggtgttagtgcctatcaacatacgtcagtgaccctg
gagttctttgaaacagtggttagatatgaaaaattctttgctgttgaacctcagcacatt
ccagctgttctgatggcattcttagatcaccgtggtcttcgccatacaagtcccaaagta
cgaagtcgaacagcttacctcttttccagatttgtcaagtctcttaataagcaaatgaat
ccctttattgaagatgttctgaatagaatacaagacctgatggaactttctcctcctgaa
aatggttaccaggcactgttaagcagtgatgatcaacttttcatttatgaaacagctgga
gtgttaatagttaacagcgaatactctgcagaaagaaaacaggttctaatgaggaatttg
ttgactccgctgatggagaagttcaaagtattgttagaaaaactgatgatggcacaggat
gaggacagacagatggcactggctgactgcctcaatcatgccgttgggtttgctagccga
actagcaaggctttcagcaataagcaaactgtaaagcaatgtggatgctcagaggtttat
ctggactgcctacaaacatttctgccagctctcagctgtccgttacaaaaagaagttctg
agaagtggtgtccgcactttccttcaccgcatgattatttgcctagaggaagaagttctt
ccattcattccttctgcctctgaacacatgcttaaagattgtgaagcaaaagatcttcaa
gaattcattcctcttataaaccaaataacggctaagtttaagacacaggtttcacctttt
ctgcaacagatgtttatgccactacttcatgctatttttgaggtgttgctccttccagca
gaagaaaatgaccagtctgctgctttagaaaaacaaatgttacggaggagttactttgct
tttctgcagacagtaactggtagtggaatgagtgaagtcatagctaatcaaggtgcagag
aatgtggagcgtgtgatgttcactgtcattcaaggcgcagtggattacccagatcctatt
gcacagaagacctgctttattattctttctaagttggtggagctttggggaggtaaagat
ggaccagtaggttttgcagactttgtctacaagcacattgttcctgcatgtttcttagca
cctttgaagcaaacatttgacttagcagatgcccagacagtactggctttatcagagtgt
gcagtgacgttaaaaacaattcatctcaaaaggggtcctgagtgcattcagtatcttcag
caagagtatttgccttctttgcaagtagctcctgagataatccaggaattctgtcaagca
cttcagcagcctgatgctaaagtttttaaaaattacttaaaggtattcttccagagagcc
aaaccctaa

DBGET integrated database retrieval system