KEGG   Empidonax traillii (willow flycatcher): 114059504
Entry
114059504         CDS       T05887                                 

Definition
(RefSeq) p53 apoptosis effector related to PMP-22-like
  KO
K10136  TP53 apoptosis effector
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114059504
SSDB
Motif
Pfam: PMP22_Claudin L_HMGIC_fpl PalH
Other DBs
NCBI-GeneID: 114059504
NCBI-ProteinID: XP_027743826
LinkDB
Position
Unknown
AA seq 189 aa
MVKYGLDYTRCRWILPLLLGIGVIFGIIALAGRGWLESQTLPYVQQASLWENCRRPDQGG
EWSCESLMGYAWGRAAAATYLVGFLLLVICFALAIIAFAIDTLRFNFIRGIGGLLFVAAV
FSIMGLVIYPVKFSSEIEMTGINMFSWAYGFGWTTAIMEICLGFFFCCLPNYEDQILGNV
KPTYFYSSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atggtgaagtacggcctcgactacactcggtgcagatggatcctacccctgctcctgggc
ataggagtcatcttcggtatcattgcgctggcgggcaggggctggttggagtcgcagacc
ttgccctacgtgcagcaagcgtccttatgggagaactgcaggaggcctgatcagggtggg
gaatggagctgcgagtccctcatgggttacgcctggggaagagctgctgctgccacatac
ctggttggctttctacttctagtcatctgttttgctctggccatcatagcgtttgccatt
gacacacttcggttcaacttcatacgtgggattggaggcttactttttgtggctgctgtg
ttctccatcatgggcctggtcatttatccagtaaagttctcatctgaaattgaaatgaca
ggaatcaatatgttcagctgggcctatggcttcggctggaccaccgctattatggaaata
tgcttgggattcttcttctgctgccttcctaactatgaagatcagatcttgggtaatgtc
aagcccacgtatttttactcttccccataa

KEGG   Empidonax traillii (willow flycatcher): 114059511
Entry
114059511         CDS       T05887                                 

Definition
(RefSeq) p53 apoptosis effector related to PMP-22-like
  KO
K10136  TP53 apoptosis effector
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114059511
SSDB
Motif
Pfam: PMP22_Claudin L_HMGIC_fpl ABC2_membrane_3
Other DBs
NCBI-GeneID: 114059511
NCBI-ProteinID: XP_027743830
LinkDB
Position
Unknown
AA seq 196 aa
MVVCGLACWRCRWLLPLLLGLAIIMGIIALAGRGWLESESEPYVQQASLWESCTRGEEDL
NWNCESLMDYGWGRAAAATYLVGFVILVICFALAVIAFSIEILRFNFVRGIGGLLFVVAA
FQIIGLVIYPVKFTEDIPLTGDNMFSWAYGFGWASTIVVIGCAFFFCCLPNWEDEVLGNI
KPTYYYSSPERAPYLN
NT seq 591 nt   +upstreamnt  +downstreamnt
atggtggtgtgcggcctcgcctgctggaggtgcaggtggctcctgccactgctgctgggc
ctggccatcatcatgggcatcatcgccctggcgggccggggctggctggagtccgagtcg
gagccctacgtgcagcaagcgtcgctgtgggagagctgcacgcggggcgaggaggacctc
aactggaactgcgaatccctcatggactacggatgggggagagcagcagctgccacatac
ctcgttggctttgtgatcctggtcatctgtttcgctcttgcagtcattgcgttctcgatc
gagatactccgcttcaactttgtgcgaggaattggaggcttgctctttgttgttgctgca
ttccagatcattggcttggtcatttacccagtgaaattcacagaagatattccactcaca
ggagataatatgttcagctgggcctatggttttggctgggccagcactatcgttgttata
ggttgtgctttcttcttctgctgcctccccaactgggaagatgaagtcctgggaaacatc
aagcctacctattactactcctccccagagagagcaccatacttaaattga

DBGET integrated database retrieval system